Clone RH45738 Report

Search the DGRC for RH45738

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:457
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG12158-RA
Protein status:RH45738.pep: gold
Preliminary Size:266
Sequenced Size:296

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12158 2002-01-01 Sim4 clustering to Release 2
CG12158 2008-04-29 Release 5.5 accounting
CG12158 2008-08-15 Release 5.9 accounting
CG12158 2008-12-18 5.12 accounting

Clone Sequence Records

RH45738.complete Sequence

296 bp (296 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071737

> RH45738.complete
CACAGTTTCAAATTCAACATGAAGCAGTTCGCATTGTTCAGCATCTTCCT
TCTAATTCTGGCTGTGGGTTTGGCACAAATGCCGCTGCAGGTGGCCGCCC
AGGGCCAAAATGGACATTCGCAGGGACAGCCGCCAAGACCGCCAAATGGC
AATGGAAACGGCAACCAGCAGAGTGGACAAGGACAAAGCGGGCAGAACAA
CTAGAACTGGGATATTTCTGGAGGGGGACACACACCTCCTCGCCACTTCC
CCAGTTACTTAAATAAACACTTTCCCCAGCAAAAAAAAAAAAAAAA

RH45738.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-RA 457 CG12158-RA 58..344 4..290 1390 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:51:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5250078..5250286 280..72 1030 99.5 Minus
chr2R 21145070 chr2R 5250339..5250408 73..4 350 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9362564..9362782 290..72 1050 98.6 Minus
2R 25286936 2R 9362835..9362904 73..4 350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9363763..9363981 290..72 1050 98.6 Minus
2R 25260384 2R 9364034..9364103 73..4 350 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:51:36 has no hits.

RH45738.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:52:44 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5250078..5250285 73..280 99 <- Minus
chr2R 5250340..5250410 1..72 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:43 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..186 19..204 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:42 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..186 19..204 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..186 19..204 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:22 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..186 19..204 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:02 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..186 19..204 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:48 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..279 3..280 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:41 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..279 3..280 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..279 3..280 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:22 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..279 3..280 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:02 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
CG12158-RA 1..279 3..280 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9362574..9362781 73..280 99 <- Minus
2R 9362836..9362906 1..72 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9362574..9362781 73..280 99 <- Minus
2R 9362836..9362906 1..72 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9362574..9362781 73..280 99 <- Minus
2R 9362836..9362906 1..72 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:14 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5250079..5250286 73..280 99 <- Minus
arm_2R 5250341..5250411 1..72 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:47 Download gff for RH45738.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9363773..9363980 73..280 99 <- Minus
2R 9364035..9364105 1..72 97   Minus

RH45738.pep Sequence

Translation from 0 to 203

> RH45738.pep
HSFKFNMKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNG
NGNGNQQSGQGQSGQNN*

RH45738.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-PA 61 CG12158-PA 1..61 7..67 319 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22357-PA 61 GE22357-PA 1..61 7..67 276 96.7 Plus

RH45738.hyp Sequence

Translation from 3 to 203

> RH45738.hyp
SFKFNMKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNGN
GNGNQQSGQGQSGQNN*

RH45738.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG12158-PA 61 CG12158-PA 1..61 6..66 319 100 Plus