RH45738.complete Sequence
296 bp (296 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071737
> RH45738.complete
CACAGTTTCAAATTCAACATGAAGCAGTTCGCATTGTTCAGCATCTTCCT
TCTAATTCTGGCTGTGGGTTTGGCACAAATGCCGCTGCAGGTGGCCGCCC
AGGGCCAAAATGGACATTCGCAGGGACAGCCGCCAAGACCGCCAAATGGC
AATGGAAACGGCAACCAGCAGAGTGGACAAGGACAAAGCGGGCAGAACAA
CTAGAACTGGGATATTTCTGGAGGGGGACACACACCTCCTCGCCACTTCC
CCAGTTACTTAAATAAACACTTTCCCCAGCAAAAAAAAAAAAAAAA
RH45738.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:37:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12158-RA | 457 | CG12158-RA | 58..344 | 4..290 | 1390 | 98.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:51:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 5250078..5250286 | 280..72 | 1030 | 99.5 | Minus |
chr2R | 21145070 | chr2R | 5250339..5250408 | 73..4 | 350 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:51:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 9362564..9362782 | 290..72 | 1050 | 98.6 | Minus |
2R | 25286936 | 2R | 9362835..9362904 | 73..4 | 350 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 9363763..9363981 | 290..72 | 1050 | 98.6 | Minus |
2R | 25260384 | 2R | 9364034..9364103 | 73..4 | 350 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 20:51:36 has no hits.
RH45738.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:52:44 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 5250078..5250285 | 73..280 | 99 | <- | Minus |
chr2R | 5250340..5250410 | 1..72 | 97 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:43 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..186 | 19..204 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:42 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..186 | 19..204 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..186 | 19..204 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:22 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..186 | 19..204 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:02 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..186 | 19..204 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:48 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..279 | 3..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:41 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..279 | 3..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..279 | 3..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:22 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..279 | 3..280 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:02 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12158-RA | 1..279 | 3..280 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 9362574..9362781 | 73..280 | 99 | <- | Minus |
2R | 9362836..9362906 | 1..72 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 9362574..9362781 | 73..280 | 99 | <- | Minus |
2R | 9362836..9362906 | 1..72 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:44 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 9362574..9362781 | 73..280 | 99 | <- | Minus |
2R | 9362836..9362906 | 1..72 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:14 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 5250079..5250286 | 73..280 | 99 | <- | Minus |
arm_2R | 5250341..5250411 | 1..72 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:47 Download gff for
RH45738.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 9363773..9363980 | 73..280 | 99 | <- | Minus |
2R | 9364035..9364105 | 1..72 | 97 | | Minus |
RH45738.pep Sequence
Translation from 0 to 203
> RH45738.pep
HSFKFNMKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNG
NGNGNQQSGQGQSGQNN*
RH45738.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12158-PA | 61 | CG12158-PA | 1..61 | 7..67 | 319 | 100 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22357-PA | 61 | GE22357-PA | 1..61 | 7..67 | 276 | 96.7 | Plus |
RH45738.hyp Sequence
Translation from 3 to 203
> RH45738.hyp
SFKFNMKQFALFSIFLLILAVGLAQMPLQVAAQGQNGHSQGQPPRPPNGN
GNGNQQSGQGQSGQNN*
RH45738.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12158-PA | 61 | CG12158-PA | 1..61 | 6..66 | 319 | 100 | Plus |