Clone RH46282 Report

Search the DGRC for RH46282

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:462
Well:82
Vector:pFlc-1
Associated Gene/Transcriptfabp-RA
Protein status:RH46282.pep: gold
Sequenced Size:1042

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31305 2002-11-20 Blastp of sequenced clone
CG6783 2008-04-29 Release 5.5 accounting
CG6783 2008-08-15 Release 5.9 accounting
CG6782 2008-08-15 Release 5.9 accounting
CG6783 2008-12-18 5.12 accounting
CG6782 2008-12-18 5.12 accounting

Clone Sequence Records

RH46282.complete Sequence

1042 bp (1042 high quality bases) assembled on 2002-11-20

GenBank Submission: BT003449

> RH46282.complete
GATTCGCTCAGAAAATTTCAACAGTGAACATCTTGTGCAGAACACAGACC
AAATATTCCAAAAATGTCTTTCGTTGGCAAGAAGTACAAGCTGGACAAGT
CCGAGAACTTCGATGAGTACATGAAGGAGCTGGTTCTGCCCTCAAACAAC
ATATGTATATATGGAATGCTGCACCGAGATAAGGTGGTGCTTTGCCAGAT
CTATATTTAAATGCATGGAGGGGCTTGCCAATTGATAAGAGCGGAGATGA
GGATGAGGGAGGAGACGACGGCCCGCATTGTTCGTTAACCTTGAGCACGA
CTTTTGACGTTACAGCGGAACGGAATCTGCAGGGAACTTCATGGCTCGGC
TTTATTATTTTTAATTAAATATGATATGATTTGCATTGTGAGCGCTTTGG
GGTCCACAACTTTGTTGGGCTAATTCAATTATGTGCAGTCTGCCCCATCA
TTCATCTTTCGGCGTCGGTCTGGTGACGCGCAAGATGGGCAACAGCCTGA
GCCCCACAGTGGAGGTGACCTTGGAGGGCGATACCTACACCCTGACTACC
ACCTCCACCTTCAAGACCTCTGCCATCAGCTTCAAGCTGGGCGTTGAGTT
CGACGAGGAGACCCTGGACGGTCGCAACGTCAAGAGCATCATCACCCTGG
ATGGCAACAAGCTGACGCAGGAGCAGAAGGGCGACAAGCCCACCACCATC
GTCCGCGAGTTCACCGACAACGAGCTGATCACCACCCTCACCATCGGCAA
CGTTAAGTGCGTGCGCGTCTACAAGGCCGTCTAAGAGACTGATCTAAAAC
TATAATATCCATACGACTACATGCATTAAAACTAACTCAGATAGCCAATA
TTCTTGTTGACTAACAGTGAACTAAACCAAATCAAATGGAACTGCACGCT
CTGCCCAATGTTAATTTATAATCGCACCCGTACACCCGCAGTCGGTGTAT
GTGGGAATACTCCTCGTACTCGGGGACCAATTTCCGAATGCATTTGAATA
AACTATTACTTGAAGTGCTTTTAAAACAAAAAAAAAAAAAAA

RH46282.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-RA 1042 CG6783-RA 1..1027 2..1028 5120 99.9 Plus
CG6783-RB 714 CG6783-RB 132..699 461..1028 2840 100 Plus
CG6783-RC 1661 CG6783-RC 132..404 461..733 1365 100 Plus
CG6783-RB 714 CG6783-RB 1..132 2..133 660 100 Plus
CG6783-RC 1661 CG6783-RC 1..132 2..133 660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7390272..7390601 462..133 1620 99.4 Minus
chr3R 27901430 chr3R 7389567..7389860 1027..734 1470 100 Minus
chr3R 27901430 chr3R 7389929..7390201 733..461 1365 100 Minus
chr3R 27901430 chr3R 7392407..7392538 133..2 660 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564783..11565112 462..133 1635 99.7 Minus
3R 32079331 3R 11564077..11564371 1028..734 1475 100 Minus
3R 32079331 3R 11564440..11564712 733..461 1365 100 Minus
3R 32079331 3R 11566918..11567049 133..2 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11305614..11305943 462..133 1635 99.6 Minus
3R 31820162 3R 11304908..11305202 1028..734 1475 100 Minus
3R 31820162 3R 11305271..11305543 733..461 1365 100 Minus
3R 31820162 3R 11307749..11307880 133..2 660 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:38:02 has no hits.

RH46282.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:51 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7389567..7389860 734..1027 100 <- Minus
chr3R 7389929..7390200 462..733 100 <- Minus
chr3R 7390273..7390600 134..461 92 <- Minus
chr3R 7392407..7392538 1..133 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:50 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..354 431..784 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:48 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..354 431..784 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:29:17 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 1..354 431..784 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:53 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..354 431..784 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:54 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 1..354 431..784 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:25 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..1026 2..1027 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:48 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..1026 2..1027 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:29:17 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 1..1026 2..1027 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:54 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..1026 2..1027 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:54 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 5..1031 1..1027 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:51 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564078..11564371 734..1027 100 <- Minus
3R 11564440..11564711 462..733 100 <- Minus
3R 11564784..11565111 134..461 99 <- Minus
3R 11566918..11567049 1..133 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:51 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564078..11564371 734..1027 100 <- Minus
3R 11564440..11564711 462..733 100 <- Minus
3R 11564784..11565111 134..461 99 <- Minus
3R 11566918..11567049 1..133 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:51 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564078..11564371 734..1027 100 <- Minus
3R 11564440..11564711 462..733 100 <- Minus
3R 11564784..11565111 134..461 99 <- Minus
3R 11566918..11567049 1..133 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:29:17 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390162..7390433 462..733 100 <- Minus
arm_3R 7389800..7390093 734..1027 100 <- Minus
arm_3R 7390506..7390833 134..461 99 <- Minus
arm_3R 7392640..7392771 1..133 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:11:24 Download gff for RH46282.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11304909..11305202 734..1027 100 <- Minus
3R 11305271..11305542 462..733 100 <- Minus
3R 11305615..11305942 134..461 99 <- Minus
3R 11307749..11307880 1..133 99   Minus

RH46282.hyp Sequence

Translation from 430 to 783

> RH46282.hyp
MCSLPHHSSFGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAIS
FKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELI
TTLTIGNVKCVRVYKAV*

RH46282.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PA 117 CG6783-PA 1..117 1..117 595 100 Plus
fabp-PB 130 CG6783-PB 24..130 11..117 536 100 Plus
fabp-PC 157 CG6783-PC 24..116 11..103 456 97.8 Plus

RH46282.pep Sequence

Translation from 430 to 783

> RH46282.pep
MCSLPHHSSFGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAIS
FKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELI
TTLTIGNVKCVRVYKAV*

RH46282.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16638-PA 130 GF16638-PA 19..130 6..117 383 81.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17215-PA 130 GG17215-PA 19..130 6..117 529 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15313-PA 131 GH15313-PA 20..131 6..117 415 83 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PA 117 CG6783-PA 1..117 1..117 595 100 Plus
fabp-PB 130 CG6783-PB 24..130 11..117 536 100 Plus
fabp-PC 157 CG6783-PC 24..116 11..103 456 97.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22452-PA 131 GI22452-PA 20..131 6..117 424 83 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12263-PA 131 GL12263-PA 20..131 6..117 384 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26243-PA 99 GA26243-PA 1..99 19..117 347 89.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26093-PA 130 GM26093-PA 19..130 6..117 530 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20655-PA 117 GD20655-PA 1..117 1..117 510 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10051-PA 131 GJ10051-PA 20..131 6..117 427 85.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11787-PA 131 GK11787-PA 20..131 6..117 426 86.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10108-PA 130 GE10108-PA 19..130 6..117 527 92.9 Plus