Clone RH46294 Report

Search the DGRC for RH46294

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:462
Well:94
Vector:pFlc-1
Associated Gene/TranscriptCG14401-RA
Protein status:RH46294.pep: gold
Sequenced Size:1256

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14401 2003-01-01 Sim4 clustering to Release 3
CG14401 2004-08-13 Blastp of sequenced clone
CG14401 2008-04-29 Release 5.5 accounting
CG14401 2008-08-15 Release 5.9 accounting
CG14401 2008-12-18 5.12 accounting

Clone Sequence Records

RH46294.complete Sequence

1256 bp (1256 high quality bases) assembled on 2004-08-13

GenBank Submission: BT015962

> RH46294.complete
GACATTCTGAATGCGATTGTTCGCACGTTCAGTTCAGTTTCTGTTTAGTT
CAGTCGCGTGTGTGCATCGCTTCGAGTCGGTGGTCGGTGGTCGGTGGTCG
GTGGTCGTTGGTCGGCGGCTTGTGGCTATATAGCGCATCTATCATGTGAT
TAAAATCGGTCCGGCAACCGAGAAGACAACATCTGTATTCGCGCACGTAT
CGGCATCGCCAAGCTATAGCTATAGCCATACTGACTCACCGCGACCGCCG
GACGACAGTGGAATCAACTGTTTTCGGGGGCGGTACGATGGCGATGATGG
CAGCGCTTGCCTCGCTCTTTCTGCTCGTCACGCTGGCCAGCTCAGCCCGT
GCCATTACCTGCTACGAATGTGATTCCGTCAATAATCCAGGGTGTGGGGA
GCGATTTGTGGGCGATGACATATCCACGACGGATTGCGATGTGGTGGCGA
ACATGCGATCCCTGGGAGCGGAGGCCACTTGCCTTACCAAGTACCATGAG
GGAATGCCAGGAGACACGCGCTTCGTGAGGCGCTCCTGTTACTTTGGCGA
TGCCTCCCCAATAGGCGTCAGTTGCGACGATGGACCAGATCCTGTGGTGC
CCTTTATGAACTTCCTCGGCTGCACACTGTGCGATACGGATTTGTGCAAC
GCAGCCGCTGGATTATCCACACTACCCTTGGTCATTGCCCTTTCGATACT
CGGACTGCTTGTCCTACTGGCGACCTAAGGAAGATGAGTCGCGTGGAACG
GCGGCGGTCGTATTTCAATGTTTCCTATTAAAAGTAATATACTCCAGTAT
TGTATAAAAGATTGTTGTTTTCTTGGTCGACTAACTAACATGACTTCTTA
TACTCATGCAAAGGGCGCAGAACAAGAACGACCCAAAGTTTATCCTTATA
TTCTTAATTTTCTAAGGCAAATGGCTTAAGTTATAAAAAGCCTACTGAAT
ATGTAATAAATTTAACTTAAAGCCCCTAGAAGAATGAAATAGAAGCAAAT
ATTTTTTAATTTTTATTTTATTTGATTTTCTTTCCATTGTTTTTATACAT
CCACTAAAATGATTTAACATACATATATATTTATATAATTATACTTGTTT
GATTTAATATAATTTATTGAATAAAATTTACTCGTTTCCTACTCTACTAG
CGTGTGTATGTAAGTATGTGTATGGTGTGTATTGCAATTAGGATCATTAA
TTACAAAATATTCATAAAATAAATTAAAATAACACTTTCGAAAAAAAAAA
AAAAAA

RH46294.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14401-RA 1237 CG14401-RA 1..1237 2..1239 6150 99.9 Plus
CG14401.a 1231 CG14401.a 1..1231 2..1239 6035 99.4 Plus
CG14401.b 1300 CG14401.b 566..1300 504..1239 3640 99.8 Plus
CG14401.b 1300 CG14401.b 1..344 2..345 1720 100 Plus
CG14401.b 1300 CG14401.b 396..554 346..504 795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20869366..20870099 505..1239 3580 99.5 Plus
chr2L 23010047 chr2L 20868382..20868725 2..345 1720 100 Plus
chr2L 23010047 chr2L 20869132..20869294 342..504 815 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20870832..20871565 505..1239 3625 99.9 Plus
2L 23513712 2L 20869848..20870191 2..345 1720 100 Plus
2L 23513712 2L 20870598..20870760 342..504 815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20870832..20871565 505..1239 3635 99.8 Plus
2L 23513712 2L 20869848..20870191 2..345 1720 100 Plus
2L 23513712 2L 20870598..20870760 342..504 815 100 Plus
Blast to na_te.dros performed 2019-03-16 19:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 5115..5212 1182..1083 125 62.4 Minus
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 4979..5020 1194..1235 120 76.2 Plus

RH46294.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:00:32 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20869136..20869294 346..504 100 -> Plus
chr2L 20869366..20869933 505..1072 94 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:51 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..441 288..728 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:48 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..441 288..728 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:45 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..441 288..728 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:16:40 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..441 288..728 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:49:15 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..441 288..728 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:38:12 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..1237 2..1239 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:48 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..1237 2..1239 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:45 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..1231 8..1239 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:16:40 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..1237 2..1239 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:15 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
CG14401-RA 1..1231 8..1239 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:32 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20869847..20870191 1..345 99 -> Plus
2L 20870602..20870760 346..504 100 -> Plus
2L 20870832..20871565 505..1240 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:32 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20869847..20870191 1..345 99 -> Plus
2L 20870602..20870760 346..504 100 -> Plus
2L 20870832..20871565 505..1240 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:32 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20869847..20870191 1..345 99 -> Plus
2L 20870602..20870760 346..504 100 -> Plus
2L 20870832..20871565 505..1240 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:45 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20869847..20870191 1..345 99 -> Plus
arm_2L 20870602..20870760 346..504 100 -> Plus
arm_2L 20870832..20871565 505..1240 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:53:38 Download gff for RH46294.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20869847..20870191 1..345 99 -> Plus
2L 20870602..20870760 346..504 100 -> Plus
2L 20870832..20871565 505..1240 99   Plus

RH46294.pep Sequence

Translation from 287 to 727

> RH46294.pep
MAMMAALASLFLLVTLASSARAITCYECDSVNNPGCGERFVGDDISTTDC
DVVANMRSLGAEATCLTKYHEGMPGDTRFVRRSCYFGDASPIGVSCDDGP
DPVVPFMNFLGCTLCDTDLCNAAAGLSTLPLVIALSILGLLVLLAT*

RH46294.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21008-PA 145 GF21008-PA 17..142 18..143 436 60.3 Plus
Dana\GF20975-PA 148 GF20975-PA 13..148 12..145 216 39.3 Plus
Dana\GF20986-PA 148 GF20986-PA 11..127 10..123 197 41.7 Plus
Dana\GF20997-PA 152 GF20997-PA 1..127 3..126 142 29.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21270-PA 144 GG21270-PA 1..132 3..134 660 95.5 Plus
Dere\GG21263-PA 148 GG21263-PA 1..148 3..145 206 36.2 Plus
Dere\GG21264-PA 147 GG21264-PA 10..147 9..145 175 35.9 Plus
Dere\GG21268-PA 147 GG21268-PA 4..147 9..145 163 31.3 Plus
Dere\GG10978-PA 159 GG10978-PA 10..139 9..129 154 30.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10594-PA 147 GH10594-PA 22..141 23..144 266 45.3 Plus
Dgri\GH10592-PA 148 GH10592-PA 13..148 12..145 210 39.3 Plus
Dgri\GH10591-PA 148 GH10591-PA 10..148 9..145 206 35.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14401-PA 146 CG14401-PA 1..146 1..146 766 100 Plus
CG14401-PC 150 CG14401-PC 1..150 1..146 751 97.3 Plus
CG14401-PB 198 CG14401-PB 1..198 1..146 699 73.2 Plus
CG9336-PA 148 CG9336-PA 4..148 2..145 214 36 Plus
CG9338-PB 147 CG9338-PB 8..147 7..145 187 35.4 Plus
CG9338-PA 147 CG9338-PA 8..147 7..145 187 35.4 Plus
CG9336-PB 115 CG9336-PB 2..115 34..145 154 34.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23230-PA 148 GI23230-PA 19..146 19..144 287 44.7 Plus
Dmoj\GI23198-PA 148 GI23198-PA 13..139 12..135 209 37.7 Plus
Dmoj\GI23209-PA 148 GI23209-PA 23..139 22..135 197 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18531-PA 150 GL18531-PA 1..150 4..146 454 59.3 Plus
Dper\GL18529-PA 148 GL18529-PA 10..148 9..145 219 40.6 Plus
Dper\GL25347-PA 148 GL25347-PA 1..148 3..145 207 36.8 Plus
Dper\GL18528-PA 115 GL18528-PA 2..115 34..145 152 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25675-PA 150 GA25675-PA 1..150 4..146 454 59.3 Plus
Dpse\GA25674-PA 148 GA25674-PA 10..148 9..145 219 40.6 Plus
Dpse\GA21711-PA 146 GA21711-PA 13..146 14..145 193 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23384-PA 146 GM23384-PA 1..130 1..130 646 95.4 Plus
Dsec\GM23380-PA 148 GM23380-PA 13..148 12..145 206 36.4 Plus
Dsec\GM23382-PA 141 GM23382-PA 1..141 3..145 177 37.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24293-PA 146 GD24293-PA 1..131 1..131 639 93.1 Plus
Dsim\GD24290-PA 148 GD24290-PA 13..148 12..145 206 36.4 Plus
Dsim\GD24291-PA 245 GD24291-PA 107..245 2..145 172 35.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23718-PA 265 GJ23718-PA 140..262 23..144 257 44.5 Plus
Dvir\GJ23708-PA 148 GJ23708-PA 23..148 22..145 211 41.5 Plus
Dvir\GJ23697-PA 148 GJ23697-PA 13..148 12..145 208 37.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15446-PA 151 GK15446-PA 1..136 1..128 351 50.7 Plus
Dwil\GK15441-PA 149 GK15441-PA 10..149 9..145 223 38.5 Plus
Dwil\GK15443-PA 148 GK15443-PA 10..148 9..145 201 38.5 Plus
Dwil\GK15444-PA 148 GK15444-PA 2..148 1..145 191 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12888-PA 147 GE12888-PA 1..130 1..130 654 95.4 Plus
Dyak\GE12885-PA 148 GE12885-PA 13..148 12..145 201 35.7 Plus
Dyak\GE12886-PA 147 GE12886-PA 10..147 9..145 169 35.2 Plus

RH46294.hyp Sequence

Translation from 287 to 727

> RH46294.hyp
MAMMAALASLFLLVTLASSARAITCYECDSVNNPGCGERFVGDDISTTDC
DVVANMRSLGAEATCLTKYHEGMPGDTRFVRRSCYFGDASPIGVSCDDGP
DPVVPFMNFLGCTLCDTDLCNAAAGLSTLPLVIALSILGLLVLLAT*

RH46294.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14401-PA 146 CG14401-PA 1..146 1..146 766 100 Plus
CG14401-PC 150 CG14401-PC 1..150 1..146 751 97.3 Plus
CG14401-PB 198 CG14401-PB 1..198 1..146 699 73.2 Plus
CG9336-PA 148 CG9336-PA 4..148 2..145 214 36 Plus
CG9338-PB 147 CG9338-PB 8..147 7..145 187 35.4 Plus