Clone RH46857 Report

Search the DGRC for RH46857

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:468
Well:57
Vector:pFlc-1
Associated Gene/TranscriptDsk-RA
Protein status:RH46857.pep: gold
Preliminary Size:387
Sequenced Size:585

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18090 2002-01-01 Sim4 clustering to Release 2
CG18090 2002-04-21 Blastp of sequenced clone
CG18090 2003-01-01 Sim4 clustering to Release 3
Dsk 2008-04-29 Release 5.5 accounting
Dsk 2008-08-15 Release 5.9 accounting
Dsk 2008-12-18 5.12 accounting

Clone Sequence Records

RH46857.complete Sequence

585 bp (585 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113595

> RH46857.complete
GACCAGTCTGCCAAGGGCACAGTAAAGCATGGGACCTAGAAGCTGTACGC
ACTTCGCCACGCTGTTTATGCCACTCTGGGCATTAGCCTTCTGCTTCCTG
GTGGTGCTGCCGATCCCAGCGCAGACGACTAGTCTACAGAACGCTAAGGA
TGATCGGCGACTACAGGAATTGGAGTCAAAAATTGGTGGGGAAATCGATC
AGCCCATTGCGAATTTAGTTGGACCATCATTCTCTCTATTCGGGGACAGG
CGTAATCAGAAAACAATGAGCTTCGGTCGCAGAGTGCCACTAATTTCACG
CCCAATAATACCAATTGAGCTGGATCTCCTCATGGATAATGATGACGAAA
GAACGAAAGCTAAGCGGTTTGATGATTACGGCCATATGAGGTTTGGTAAA
AGGGGAGGTGATGATCAGTTCGATGACTACGGTCACATGCGTTTCGGCCG
ATAAACACTTGCCATCAGTTTAGTCATTTAGAAAACCGATTATGTATATT
GTACATAGAAATTAATCGAGCACACATTTTATATTAACAAGTATATAAAA
AGTAATAAATGTTCGCATTCAAAAAAAAAAAAAAA

RH46857.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsk-RA 783 Dsk-RA 189..762 2..575 2870 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15414..15982 570..2 2845 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:30:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4189687..4190260 575..2 2870 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3930518..3931091 575..2 2870 100 Minus
Blast to na_te.dros performed 2019-03-16 14:34:23
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy9 5349 gypsy9 GYPSY9 5349bp 413..461 503..551 110 69.4 Plus

RH46857.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:35:02 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15414..15982 1..570 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:55 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..426 29..454 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:28 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..426 29..454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:59:07 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..426 29..454 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:22 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..426 29..454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:07 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..426 29..454 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:23:51 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 188..757 1..570 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:28 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 188..757 1..570 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:59:07 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..569 2..570 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:22 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 188..757 1..570 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:07 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
Dsk-RA 1..569 2..570 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:02 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4189692..4190260 1..570 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:02 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4189692..4190260 1..570 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:35:02 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4189692..4190260 1..570 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:59:07 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15414..15982 1..570 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:50 Download gff for RH46857.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3930523..3931091 1..570 99   Minus

RH46857.pep Sequence

Translation from 28 to 453

> RH46857.pep
MGPRSCTHFATLFMPLWALAFCFLVVLPIPAQTTSLQNAKDDRRLQELES
KIGGEIDQPIANLVGPSFSLFGDRRNQKTMSFGRRVPLISRPIIPIELDL
LMDNDDERTKAKRFDDYGHMRFGKRGGDDQFDDYGHMRFGR*

RH46857.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19919-PA 143 GF19919-PA 1..143 1..141 434 59.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Dsk-PA 141 GG11807-PA 1..141 1..141 643 85.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21339-PA 127 GH21339-PA 3..127 9..141 280 48.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsk-PA 141 CG18090-PA 1..141 1..141 751 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10499-PA 142 GI10499-PA 28..142 28..141 273 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12302-PA 139 GL12302-PA 1..139 1..141 498 66.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Dsk-PA 139 GA14787-PA 1..139 1..141 496 65.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Dsk-PA 141 GM10727-PA 1..141 1..141 692 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Dsk-PA 141 GD19701-PA 1..141 1..141 680 90.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23179-PA 141 GJ23179-PA 1..141 1..141 286 41.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11022-PA 141 GK11022-PA 1..141 1..141 366 52.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Dsk-PA 137 GE25375-PA 1..137 1..141 588 80.1 Plus
Dyak\GE14608-PA 137 GE14608-PA 1..137 1..141 588 80.1 Plus

RH46857.hyp Sequence

Translation from 28 to 453

> RH46857.hyp
MGPRSCTHFATLFMPLWALAFCFLVVLPIPAQTTSLQNAKDDRRLQELES
KIGGEIDQPIANLVGPSFSLFGDRRNQKTMSFGRRVPLISRPIIPIELDL
LMDNDDERTKAKRFDDYGHMRFGKRGGDDQFDDYGHMRFGR*

RH46857.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsk-PA 141 CG18090-PA 1..141 1..141 751 100 Plus