BDGP Sequence Production Resources |
Search the DGRC for RH46857
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 468 |
Well: | 57 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Dsk-RA |
Protein status: | RH46857.pep: gold |
Preliminary Size: | 387 |
Sequenced Size: | 585 |
Gene | Date | Evidence |
---|---|---|
CG18090 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18090 | 2002-04-21 | Blastp of sequenced clone |
CG18090 | 2003-01-01 | Sim4 clustering to Release 3 |
Dsk | 2008-04-29 | Release 5.5 accounting |
Dsk | 2008-08-15 | Release 5.9 accounting |
Dsk | 2008-12-18 | 5.12 accounting |
585 bp (585 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113595
> RH46857.complete GACCAGTCTGCCAAGGGCACAGTAAAGCATGGGACCTAGAAGCTGTACGC ACTTCGCCACGCTGTTTATGCCACTCTGGGCATTAGCCTTCTGCTTCCTG GTGGTGCTGCCGATCCCAGCGCAGACGACTAGTCTACAGAACGCTAAGGA TGATCGGCGACTACAGGAATTGGAGTCAAAAATTGGTGGGGAAATCGATC AGCCCATTGCGAATTTAGTTGGACCATCATTCTCTCTATTCGGGGACAGG CGTAATCAGAAAACAATGAGCTTCGGTCGCAGAGTGCCACTAATTTCACG CCCAATAATACCAATTGAGCTGGATCTCCTCATGGATAATGATGACGAAA GAACGAAAGCTAAGCGGTTTGATGATTACGGCCATATGAGGTTTGGTAAA AGGGGAGGTGATGATCAGTTCGATGACTACGGTCACATGCGTTTCGGCCG ATAAACACTTGCCATCAGTTTAGTCATTTAGAAAACCGATTATGTATATT GTACATAGAAATTAATCGAGCACACATTTTATATTAACAAGTATATAAAA AGTAATAAATGTTCGCATTCAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsk-RA | 783 | Dsk-RA | 189..762 | 2..575 | 2870 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 15414..15982 | 570..2 | 2845 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 4189687..4190260 | 575..2 | 2870 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 3930518..3931091 | 575..2 | 2870 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
gypsy9 | 5349 | gypsy9 GYPSY9 5349bp | 413..461 | 503..551 | 110 | 69.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 15414..15982 | 1..570 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..426 | 29..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..426 | 29..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..426 | 29..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..426 | 29..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..426 | 29..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 188..757 | 1..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 188..757 | 1..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..569 | 2..570 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 188..757 | 1..570 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dsk-RA | 1..569 | 2..570 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4189692..4190260 | 1..570 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4189692..4190260 | 1..570 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 4189692..4190260 | 1..570 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 15414..15982 | 1..570 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 3930523..3931091 | 1..570 | 99 | Minus |
Translation from 28 to 453
> RH46857.pep MGPRSCTHFATLFMPLWALAFCFLVVLPIPAQTTSLQNAKDDRRLQELES KIGGEIDQPIANLVGPSFSLFGDRRNQKTMSFGRRVPLISRPIIPIELDL LMDNDDERTKAKRFDDYGHMRFGKRGGDDQFDDYGHMRFGR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19919-PA | 143 | GF19919-PA | 1..143 | 1..141 | 434 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\Dsk-PA | 141 | GG11807-PA | 1..141 | 1..141 | 643 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21339-PA | 127 | GH21339-PA | 3..127 | 9..141 | 280 | 48.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsk-PA | 141 | CG18090-PA | 1..141 | 1..141 | 751 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10499-PA | 142 | GI10499-PA | 28..142 | 28..141 | 273 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12302-PA | 139 | GL12302-PA | 1..139 | 1..141 | 498 | 66.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Dsk-PA | 139 | GA14787-PA | 1..139 | 1..141 | 496 | 65.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\Dsk-PA | 141 | GM10727-PA | 1..141 | 1..141 | 692 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Dsk-PA | 141 | GD19701-PA | 1..141 | 1..141 | 680 | 90.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23179-PA | 141 | GJ23179-PA | 1..141 | 1..141 | 286 | 41.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11022-PA | 141 | GK11022-PA | 1..141 | 1..141 | 366 | 52.8 | Plus |
Translation from 28 to 453
> RH46857.hyp MGPRSCTHFATLFMPLWALAFCFLVVLPIPAQTTSLQNAKDDRRLQELES KIGGEIDQPIANLVGPSFSLFGDRRNQKTMSFGRRVPLISRPIIPIELDL LMDNDDERTKAKRFDDYGHMRFGKRGGDDQFDDYGHMRFGR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsk-PA | 141 | CG18090-PA | 1..141 | 1..141 | 751 | 100 | Plus |