Clone RH47216 Report

Search the DGRC for RH47216

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:472
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG33506-RA
Protein status:RH47216.pep: gold
Sequenced Size:1066

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33506 2008-04-29 Release 5.5 accounting
CG33506 2008-04-29 Picked prior to 5.5
CG33506 2008-08-15 Release 5.9 accounting
CG33506 2008-12-18 5.12 accounting

Clone Sequence Records

RH47216.complete Sequence

1066 bp assembled on 2007-11-15

GenBank Submission: BT031299

> RH47216.complete
GACAAAACAATAAGTGCTGAAATGTTGCCGAAATTAAAAACCGGTGGAGG
GTTCTTCTCCTATTTTAAGACTGAAAAGGGCCGAAAACTCGTATTCTACG
CGGCGGGAGCCACCACAGTGGGCCTCTTTCTTGGAAACTTCCTGCCGCAC
ACATTCGGCCTGAAATATTACCGCGATTTCGTGCAATGCTACCAACACGG
CGTGGGGCGTCCAGTGCCGGAGGCAGTGCAGCAGCGCCTGGAAAAGGCAT
TGGATCAGCTGGGCGTGACGCCCTTTGAGCGAAAGTTTGTGAAGCCCTTC
ACCGTCTTTGGATTCGATGTTTTCCAGGCGGGCACCACTAAGTTTCGATT
TGGAGGCGCTTTGGGCATACCGGTGAACTATGGATACGACAGTCTGGAGG
AGATTAAGCGGGCAGACATTCGGTTTAGAGACAAACAGATCAACTGGAGT
TCTCCCAGCGGAAAACTGCTAGAGGAAGCCATCGTTTTGAATGAGGATGA
ACAGATTTTCGGTCTTAGCAAGGCTGTTCTGCAGATGCAAACCCATCGGG
TACTGCTCAACTCCATCTTTCCCAGCGTCAGCTTTCTTATGGTTTACACC
ATGGGTCACTACCTCAACCTGCGGCTAGATCTCTTCGCCCGCCATGGAAG
CGTGCGGTTTGTGCTCTACAGCATTCTGGGTCTGTTTGGCTTAGGGCTCT
GGTCCTTCATGAAAGACTACAATCAGGTCTCTACGGACGCAGAGATTGAC
CAGCGACTGGCCACGATGGGTCCCCAACTTGTGGCAGCTGGAGCTAGCTT
TTACGACAAACATCTAAAGAAGAACATCGCGCTGAGGGAGCTGATTGGAA
ATGACGTTTACACTGCACTGGGCAACGAAAACTATATGATTCGGCAAAAG
TCCATGCCGCTAACAGCACGAAAATCTTTCTTCCTGGAGAAGCTGGAGGA
ACTCAAAAAGGCGCAACAGCCTGAAACAGAGTAAACACACATTTATTGTT
ACATTTTTATTGCCGGTTGAAGAAAATATATATGTTTCCAATAACTTTAC
AAAAAAAAAAAAAAAA

RH47216.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG33506-RA 1191 CG33506-RA 133..1184 2..1053 5260 100 Plus
HPS-RA 2059 HPS-RA 2003..2059 1053..997 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10745231..10745690 654..195 2285 99.8 Minus
chr2R 21145070 chr2R 10744773..10745171 1050..652 1995 100 Minus
chr2R 21145070 chr2R 10745750..10745942 194..2 950 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14857905..14858364 654..195 2300 100 Minus
2R 25286936 2R 14857444..14857845 1053..652 2010 100 Minus
2R 25286936 2R 14858424..14858616 194..2 965 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14859104..14859563 654..195 2300 100 Minus
2R 25260384 2R 14858643..14859044 1053..652 2010 100 Minus
2R 25260384 2R 14859623..14859815 194..2 965 100 Minus
Blast to na_te.dros performed 2019-03-15 23:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 228..271 57..15 118 77.3 Minus
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 8463..8506 57..15 118 77.3 Minus

RH47216.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:15:30 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10745750..10745942 1..194 98   Minus
chr2R 10744773..10745171 652..1050 100 <- Minus
chr2R 10745234..10745690 195..651 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:58 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..963 22..984 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:07:02 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..963 22..984 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:19 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..963 22..984 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:53:17 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..963 22..984 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:25:38 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..963 22..984 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:03:25 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..1037 12..1048 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:07:02 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 17..1066 1..1050 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:19 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 24..1073 1..1050 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:53:18 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 1..1037 12..1048 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:25:38 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
CG33506-RA 24..1073 1..1050 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:30 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14857447..14857845 652..1050 100 <- Minus
2R 14857908..14858364 195..651 100 <- Minus
2R 14858424..14858616 1..194 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:30 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14857447..14857845 652..1050 100 <- Minus
2R 14857908..14858364 195..651 100 <- Minus
2R 14858424..14858616 1..194 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:30 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14857447..14857845 652..1050 100 <- Minus
2R 14857908..14858364 195..651 100 <- Minus
2R 14858424..14858616 1..194 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:19 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10745929..10746121 1..194 99   Minus
arm_2R 10744952..10745350 652..1050 100 <- Minus
arm_2R 10745413..10745869 195..651 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:59:19 Download gff for RH47216.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14858646..14859044 652..1050 100 <- Minus
2R 14859107..14859563 195..651 100 <- Minus
2R 14859623..14859815 1..194 99   Minus

RH47216.hyp Sequence

Translation from 3 to 983

> RH47216.hyp
KTISAEMLPKLKTGGGFFSYFKTEKGRKLVFYAAGATTVGLFLGNFLPHT
FGLKYYRDFVQCYQHGVGRPVPEAVQQRLEKALDQLGVTPFERKFVKPFT
VFGFDVFQAGTTKFRFGGALGIPVNYGYDSLEEIKRADIRFRDKQINWSS
PSGKLLEEAIVLNEDEQIFGLSKAVLQMQTHRVLLNSIFPSVSFLMVYTM
GHYLNLRLDLFARHGSVRFVLYSILGLFGLGLWSFMKDYNQVSTDAEIDQ
RLATMGPQLVAAGASFYDKHLKKNIALRELIGNDVYTALGNENYMIRQKS
MPLTARKSFFLEKLEELKKAQQPETE*

RH47216.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG33506-PA 320 CG33506-PA 1..320 7..326 1657 100 Plus

RH47216.pep Sequence

Translation from 21 to 983

> RH47216.pep
MLPKLKTGGGFFSYFKTEKGRKLVFYAAGATTVGLFLGNFLPHTFGLKYY
RDFVQCYQHGVGRPVPEAVQQRLEKALDQLGVTPFERKFVKPFTVFGFDV
FQAGTTKFRFGGALGIPVNYGYDSLEEIKRADIRFRDKQINWSSPSGKLL
EEAIVLNEDEQIFGLSKAVLQMQTHRVLLNSIFPSVSFLMVYTMGHYLNL
RLDLFARHGSVRFVLYSILGLFGLGLWSFMKDYNQVSTDAEIDQRLATMG
PQLVAAGASFYDKHLKKNIALRELIGNDVYTALGNENYMIRQKSMPLTAR
KSFFLEKLEELKKAQQPETE*

RH47216.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12084-PA 318 GF12084-PA 1..318 1..320 1455 84.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22390-PA 320 GG22390-PA 1..320 1..320 1592 91.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22987-PA 355 GH22987-PA 37..342 6..311 1338 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG33506-PA 320 CG33506-PA 1..320 1..320 1657 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18955-PA 319 GI18955-PA 4..310 6..312 1311 76.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10826-PA 324 GL10826-PA 6..322 6..320 1463 85.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24503-PA 324 GA24503-PA 6..322 6..320 1461 84.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20173-PA 320 GM20173-PA 1..320 1..320 1639 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25650-PA 320 GD25650-PA 1..320 1..320 1646 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21561-PA 319 GJ21561-PA 4..314 6..316 1333 76.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22123-PA 323 GK22123-PA 1..319 2..319 1307 74.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12279-PA 320 GE12279-PA 1..320 1..320 1593 92.8 Plus