Clone RH47312 Report

Search the DGRC for RH47312

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:473
Well:12
Vector:pFlc-1
Associated Gene/TranscriptGstD1-RA
Protein status:RH47312.pep: gold
Preliminary Size:808
Sequenced Size:840

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10045 2002-01-01 Sim4 clustering to Release 2
CG10045 2002-06-10 Blastp of sequenced clone
GstD1 2008-04-29 Release 5.5 accounting
GstD1 2008-08-15 Release 5.9 accounting
GstD1 2008-12-18 5.12 accounting

Clone Sequence Records

RH47312.complete Sequence

840 bp (840 high quality bases) assembled on 2002-06-10

GenBank Submission: AY121705

> RH47312.complete
GAGTTCAGTGCTACTTTTCATTTGATACAGTGTACATCGCGAGTTTCACA
ACAGAAGAAAAAAATTAAAATGGTTGACTTCTACTACCTGCCCGGCTCCT
CCCCCTGCCGCTCCGTGATCATGACCGCCAAGGCCGTGGGCGTCGAGCTG
AACAAGAAGCTGCTCAACCTGCAGGCCGGTGAGCACCTGAAGCCGGAGTT
CCTGAAGATCAATCCCCAGCACACCATTCCCACGCTGGTGGACAACGGAT
TCGCGCTGTGGGAGTCCCGCGCCATCCAGGTGTATTTGGTGGAGAAGTAC
GGCAAGACCGACTCCCTGTACCCTAAGTGCCCCAAGAAGCGCGCCGTGAT
CAATCAGCGCCTGTACTTCGACATGGGAACGCTGTACCAGAGCTTCGCCA
ACTACTACTACCCACAGGTGTTCGCCAAGGCGCCCGCCGATCCAGAGGCC
TTCAAGAAGATCGAGGCCGCCTTCGAGTTCCTGAACACCTTCCTGGAGGG
ACAGGACTACGCCGCCGGTGACTCCCTTACCGTAGCCGACATTGCCCTGG
TGGCAACCGTGTCCACATTCGAGGTGGCCAAATTCGAGATCAGCAAGTAC
GCCAATGTGAACAGGTGGTACGAGAACGCCAAGAAGGTGACTCCCGGATG
GGAGGAGAACTGGGCCGGATGCCTGGAGTTCAAGAAGTACTTCGAATAAG
CCTGATATTCACGTTTTTATACCCGTACATATGATGTAGTATTTATATTC
ACGTTCACAAACAACAATTCCAAATTCGCCTGTCTCCAAAGACAATAAAT
AAGTGTTCTTTTTTTTGAATGCACAAAAAAAAAAAAAAAA

RH47312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
GstD1-RA 828 GstD1-RA 1..826 3..828 4130 100 Plus
GstD1-RB 1149 GstD1-RB 121..883 66..828 3815 100 Plus
GstD1.a 840 GstD1.a 82..840 66..824 3795 100 Plus
GstD1.a 840 GstD1.a 1..64 3..66 320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8193194..8193952 824..66 3795 100 Minus
chr3R 27901430 chr3R 8197408..8197966 106..664 815 76.4 Plus
chr3R 27901430 chr3R 8201290..8201735 218..663 715 77.4 Plus
chr3R 27901430 chr3R 8205421..8206013 76..668 670 74.2 Plus
chr3R 27901430 chr3R 8190297..8190800 695..192 660 75.4 Minus
chr3R 27901430 chr3R 8199650..8199850 184..384 480 82.6 Plus
chr3R 27901430 chr3R 8191920..8192268 424..76 425 74.8 Minus
chr3R 27901430 chr3R 8203991..8204254 127..387 370 76.9 Plus
chr3R 27901430 chr3R 8194580..8194642 65..3 315 100 Minus
chr3R 27901430 chr3R 8198577..8199065 181..669 315 71 Plus
chr3R 27901430 chr3R 8202685..8202886 205..406 230 74.3 Plus
chr3R 27901430 chr3R 8199920..8200129 454..663 225 73.8 Plus
chr2R 21145070 chr2R 14287919..14287976 181..238 185 87.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12367813..12368575 828..66 3815 100 Minus
3R 32079331 3R 12372031..12372589 106..664 815 76.4 Plus
3R 32079331 3R 12375800..12376354 109..663 780 76 Plus
3R 32079331 3R 12380039..12380631 76..668 670 74.2 Plus
3R 32079331 3R 12364920..12365423 695..192 645 75.2 Minus
3R 32079331 3R 12374264..12374464 184..384 480 82.6 Plus
3R 32079331 3R 12366543..12366891 424..76 425 74.8 Minus
3R 32079331 3R 12378609..12378872 127..387 370 76.9 Plus
3R 32079331 3R 12369203..12369265 65..3 315 100 Minus
3R 32079331 3R 12373190..12373678 181..669 315 71 Plus
3R 32079331 3R 12377304..12377505 205..406 230 74.3 Plus
3R 32079331 3R 12374534..12374743 454..663 225 73.8 Plus
2R 25286936 2R 18400874..18400931 181..238 185 87.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12108644..12109406 828..66 3815 100 Minus
3R 31820162 3R 12116710..12116932 188..410 530 82.5 Plus
3R 31820162 3R 12115095..12115295 184..384 480 82.5 Plus
3R 31820162 3R 12112934..12113062 178..306 375 86 Plus
3R 31820162 3R 12121274..12121462 480..668 360 79.3 Plus
3R 31820162 3R 12119440..12119629 127..316 350 78.9 Plus
3R 31820162 3R 12105942..12106099 504..347 340 81 Minus
3R 31820162 3R 12110034..12110096 65..3 315 100 Minus
3R 31820162 3R 12113087..12113166 331..410 280 90 Plus
3R 31820162 3R 12120971..12121097 177..303 275 81.1 Plus
3R 31820162 3R 12107497..12107722 301..76 275 74.7 Minus
3R 31820162 3R 12113339..12113420 583..664 260 87.8 Plus
3R 31820162 3R 12106140..12106254 306..192 245 80.8 Minus
3R 31820162 3R 12117105..12117185 583..663 240 86.4 Plus
3R 31820162 3R 12114021..12114167 181..327 225 76.8 Plus
3R 31820162 3R 12105751..12105849 695..597 225 81.8 Minus
3R 31820162 3R 12116967..12117094 445..572 220 78.1 Plus
3R 31820162 3R 12107374..12107486 424..312 205 78.7 Minus
3R 31820162 3R 12118219..12118336 289..406 185 77.1 Plus
3R 31820162 3R 12107128..12107179 664..613 170 88.4 Minus
3R 31820162 3R 12119783..12119835 467..519 145 84.9 Plus
3R 31820162 3R 12120870..12120955 76..161 145 77.9 Plus
3R 31820162 3R 12114312..12114351 472..511 140 90 Plus
3R 31820162 3R 12115469..12115574 558..663 140 75.4 Plus
Blast to na_te.dros performed 2019-03-15 22:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 579..608 792..821 114 86.7 Plus

RH47312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:44 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8193194..8193952 66..824 100 <- Minus
chr3R 8194580..8194642 1..65 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:47:59 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RB 1..630 70..699 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:36 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RB 1..630 70..699 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:11 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..630 70..699 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:16:04 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RB 1..630 70..699 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:36 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..630 70..699 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:53:30 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:36 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:11 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:16:04 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 1..822 3..824 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:36 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
GstD1-RA 2..825 1..824 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:44 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12369203..12369265 1..65 96   Minus
3R 12367817..12368575 66..824 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:44 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12369203..12369265 1..65 96   Minus
3R 12367817..12368575 66..824 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:44 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12369203..12369265 1..65 96   Minus
3R 12367817..12368575 66..824 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:11 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8193539..8194297 66..824 100 <- Minus
arm_3R 8194925..8194987 1..65 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:49:19 Download gff for RH47312.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12108648..12109406 66..824 100 <- Minus
3R 12110034..12110096 1..65 96   Minus

RH47312.hyp Sequence

Translation from 3 to 698

> RH47312.hyp
FSATFHLIQCTSRVSQQKKKIKMVDFYYLPGSSPCRSVIMTAKAVGVELN
KKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWESRAIQVYLVEKYG
KTDSLYPKCPKKRAVINQRLYFDMGTLYQSFANYYYPQVFAKAPADPEAF
KKIEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEISKYA
NVNRWYENAKKVTPGWEENWAGCLEFKKYFE*

RH47312.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
GstD1-PB 209 CG10045-PB 1..209 23..231 1108 100 Plus
GstD1-PA 209 CG10045-PA 1..209 23..231 1108 100 Plus
GstD10-PB 210 CG18548-PB 1..209 24..231 817 71.3 Plus
GstD10-PA 210 CG18548-PA 1..209 24..231 817 71.3 Plus
GstD2-PA 215 CG4181-PA 1..208 24..231 802 70.2 Plus

RH47312.pep Sequence

Translation from 69 to 698

> RH47312.pep
MVDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQ
HTIPTLVDNGFALWESRAIQVYLVEKYGKTDSLYPKCPKKRAVINQRLYF
DMGTLYQSFANYYYPQVFAKAPADPEAFKKIEAAFEFLNTFLEGQDYAAG
DSLTVADIALVATVSTFEVAKFEISKYANVNRWYENAKKVTPGWEENWAG
CLEFKKYFE*

RH47312.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17052-PA 209 GF17052-PA 1..209 1..209 1088 97.1 Plus
Dana\GF17054-PA 210 GF17054-PA 1..209 2..209 849 72.7 Plus
Dana\GF17943-PA 218 GF17943-PA 1..206 2..206 800 71.4 Plus
Dana\GF17947-PA 214 GF17947-PA 1..208 2..209 768 65.9 Plus
Dana\GF17942-PA 398 GF17942-PA 185..386 8..209 748 67.3 Plus
Dana\GF17942-PA 398 GF17942-PA 1..183 18..201 588 57.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GstD1-PA 209 GG17135-PA 1..209 1..209 1080 96.2 Plus
Dere\GG17138-PA 210 GG17138-PA 1..209 2..209 830 71.8 Plus
Dere\GG17139-PA 210 GG17139-PA 1..209 2..209 823 70.3 Plus
Dere\GG18761-PA 215 GG18761-PA 1..208 2..209 814 71.2 Plus
Dere\GG18783-PA 216 GG18783-PA 1..208 2..209 788 67.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20186-PA 209 GH20186-PA 1..209 1..209 1060 93.8 Plus
Dgri\GH13103-PA 209 GH13103-PA 1..209 1..209 1057 93.3 Plus
Dgri\GH13113-PA 210 GH13113-PA 1..208 2..208 805 68.8 Plus
Dgri\GH20197-PA 210 GH20197-PA 1..208 2..208 804 68.8 Plus
Dgri\GH20559-PA 216 GH20559-PA 1..208 2..209 784 66.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
GstD1-PB 209 CG10045-PB 1..209 1..209 1108 100 Plus
GstD1-PA 209 CG10045-PA 1..209 1..209 1108 100 Plus
GstD10-PB 210 CG18548-PB 1..209 2..209 817 71.3 Plus
GstD10-PA 210 CG18548-PA 1..209 2..209 817 71.3 Plus
GstD2-PA 215 CG4181-PA 1..208 2..209 802 70.2 Plus
GstD4-PA 215 CG11512-PA 1..208 2..209 779 68.8 Plus
GstD5-PA 216 CG12242-PA 1..208 2..209 779 68.3 Plus
GstD8-PA 212 CG4421-PA 1..205 2..206 762 68.3 Plus
GstD9-PB 218 CG10091-PB 1..210 1..208 761 65.7 Plus
GstD9-PA 218 CG10091-PA 1..210 1..208 761 65.7 Plus
GstD3-PA 199 CG4381-PA 1..192 18..209 668 63 Plus
GstD6-PA 215 CG4423-PA 1..206 2..207 652 59.2 Plus
GstD7-PA 224 CG4371-PA 4..212 2..209 642 58.9 Plus
GstD11-PA 222 CG17639-PA 7..190 5..188 479 46.2 Plus
GstD11-PB 243 CG17639-PB 28..211 5..188 479 46.2 Plus
GstE3-PA 220 CG17524-PA 7..199 5..196 396 42.8 Plus
GstE7-PA 223 CG17531-PA 7..212 5..207 387 40.3 Plus
GstE1-PA 224 CG5164-PA 14..196 11..190 371 43.2 Plus
GstE11-PB 225 CG5224-PB 8..203 5..197 365 40.2 Plus
GstE11-PA 225 CG5224-PA 8..203 5..197 365 40.2 Plus
GstE8-PB 222 CG17533-PB 7..200 5..196 358 37.9 Plus
GstE8-PA 222 CG17533-PA 7..200 5..196 358 37.9 Plus
GstE12-PC 223 CG16936-PC 7..214 5..209 358 39.9 Plus
GstE12-PB 223 CG16936-PB 7..214 5..209 358 39.9 Plus
GstE12-PD 223 CG16936-PD 7..214 5..209 358 39.9 Plus
GstE12-PA 223 CG16936-PA 7..214 5..209 358 39.9 Plus
GstE6-PA 222 CG17530-PA 7..214 5..209 353 37.1 Plus
GstE10-PB 240 CG17522-PB 7..202 5..197 347 37.1 Plus
GstE10-PA 240 CG17522-PA 7..202 5..197 347 37.1 Plus
GstE2-PA 221 CG17523-PA 8..209 5..207 336 38 Plus
GstE4-PA 222 CG17525-PA 4..209 2..204 331 34.5 Plus
GstE9-PA 221 CG17534-PA 7..190 5..185 330 38.6 Plus
gfzf-PD 234 CG33546-PD 4..209 5..207 329 36.4 Plus
gfzf-PE 1045 CG33546-PE 815..1020 5..207 329 36.4 Plus
gfzf-PB 1045 CG33546-PB 815..1020 5..207 329 36.4 Plus
GstE5-PA 222 CG17527-PA 7..210 5..205 318 35.6 Plus
GstE13-PB 226 CG11784-PB 7..201 5..196 291 33.8 Plus
GstE13-PA 226 CG11784-PA 7..201 5..196 291 33.8 Plus
GstE14-PA 232 CG4688-PA 9..213 5..209 272 30.8 Plus
GstT1-PA 228 CG30000-PA 5..211 2..196 165 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24379-PA 209 GI24379-PA 1..209 1..209 1056 93.3 Plus
Dmoj\GI22354-PA 208 GI22354-PA 1..208 2..209 1011 88.5 Plus
Dmoj\GI23193-PA 214 GI23193-PA 1..195 2..196 795 73.3 Plus
Dmoj\GI23195-PA 216 GI23195-PA 1..208 2..209 770 66.3 Plus
Dmoj\GI22356-PA 210 GI22356-PA 1..209 2..209 752 64.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27184-PA 209 GL27184-PA 1..209 1..209 1082 96.2 Plus
Dper\GL27300-PA 217 GL27300-PA 1..208 2..209 818 70.7 Plus
Dper\GL27186-PA 209 GL27186-PA 1..208 2..209 797 69.9 Plus
Dper\GL27303-PA 213 GL27303-PA 1..209 2..209 760 65.1 Plus
Dper\GL27185-PA 216 GL27185-PA 1..209 2..208 740 67.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10031-PA 209 GA10031-PA 1..209 1..209 1082 96.2 Plus
Dpse\GA18009-PA 219 GA18009-PA 1..208 2..209 819 70.7 Plus
Dpse\GA14986-PA 209 GA14986-PA 1..208 2..209 790 68.9 Plus
Dpse\GA18171-PA 213 GA18171-PA 1..209 2..209 758 65.1 Plus
Dpse\GA10065-PA 216 GA10065-PA 1..209 2..208 749 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GstD1-PA 209 GM26019-PA 1..209 1..209 1082 96.2 Plus
Dsec\GM26022-PA 210 GM26022-PA 1..209 2..209 820 69.9 Plus
Dsec\GM24021-PA 212 GM24021-PA 1..208 2..209 785 68.3 Plus
Dsec\GM24018-PA 215 GM24018-PA 1..208 2..209 779 67.3 Plus
Dsec\GM26021-PA 218 GM26021-PA 1..210 1..208 727 66.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GstD1-PA 209 GD20577-PA 1..209 1..209 1089 97.1 Plus
Dsim\GD20579-PA 210 GD20579-PA 1..209 2..209 827 70.8 Plus
Dsim\GD18815-PA 215 GD18815-PA 1..208 2..209 814 70.7 Plus
Dsim\GD18817-PA 215 GD18817-PA 1..208 2..209 795 69.2 Plus
Dsim\GD18821-PA 212 GD18821-PA 1..208 2..209 782 67.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24385-PA 209 GJ24385-PA 1..209 1..209 1045 93.3 Plus
Dvir\GJ14446-PA 213 GJ14446-PA 1..204 2..205 771 67.2 Plus
Dvir\GJ22854-PA 213 GJ22854-PA 1..205 2..206 765 66.8 Plus
Dvir\GJ22852-PA 214 GJ22852-PA 1..195 2..196 743 67.2 Plus
Dvir\GJ24386-PA 214 GJ24386-PA 1..210 1..208 739 67.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11204-PA 209 GK11204-PA 1..209 1..209 1070 95.2 Plus
Dwil\GK11874-PA 219 GK11874-PA 1..208 2..209 846 71.6 Plus
Dwil\GK11206-PA 210 GK11206-PA 1..209 2..209 817 71.3 Plus
Dwil\GK11202-PA 218 GK11202-PA 4..211 2..209 814 69.7 Plus
Dwil\GK11871-PA 215 GK11871-PA 1..203 2..205 776 67.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GstD1-PA 209 GE24527-PA 1..209 1..209 1096 98.1 Plus
Dyak\GE26175-PA 215 GE26175-PA 1..208 2..209 831 71.6 Plus
Dyak\GE24529-PA 210 GE24529-PA 1..209 2..209 821 70.8 Plus
Dyak\GE26178-PA 216 GE26178-PA 1..208 2..209 801 68.8 Plus
Dyak\GE26181-PA 212 GE26181-PA 1..208 2..209 800 68.8 Plus