Clone RH47329 Report

Search the DGRC for RH47329

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:473
Well:29
Vector:pFlc-1
Associated Gene/TranscriptAk6-RA
Protein status:RH47329.pep: gold
Preliminary Size:590
Sequenced Size:748

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8816 2001-12-17 Blastp of sequenced clone
CG8816 2002-01-01 Sim4 clustering to Release 2
CG8816 2003-01-01 Sim4 clustering to Release 3
CG8816 2008-04-29 Release 5.5 accounting
CG8816 2008-08-15 Release 5.9 accounting
CG8816 2008-12-18 5.12 accounting

Clone Sequence Records

RH47329.complete Sequence

748 bp (748 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071739

> RH47329.complete
GACCATGTGTACTAAAGAAACTAAGTTGACAGCTCCGGTTCTTAAGTATA
AACAACTTTGCTTCACGTGCTAAACGTTATAAGTAACAAAAATAAAAGGT
TGTTTTCTGGTCCAATATATACCCAACTGATTAGTAAAAGCTATGTCAGA
ACCAGAGCCAGATGTCAAGCCCAACATACTAATAACCGGAACTCCTGGAG
CGGGGAAATCGTATTTATGCGAACGTATAGCCTCCGAACTAAAGTTTGAG
TGGCTGGACTGCTCCAAAATCGCCAAGGAGAAAAATTTTGTAGAGGAATA
TGACGAGGAGTACGATTGTCCCATTCTGGATGAAGAAAAGCTGATGGATC
ACTTGGAGCCCCTGATGGCAAAGGGGGGCAACGTCGTCGAGTATCATGGC
TGTGATTTCTTTCCAGAGCGCTGGTTTCAAGCCGTCTTCGTGGTAACCTG
TCCCAATACAACACTCTACGATCGTCTGAAGGAGCGCAACTACAACGAAA
AGAAACTGGCATCCAATATTCAGTGCGAGATCTTTGGAACCATTTTGGAA
GAGGCCCGCGATTCCTACAAATCAGATATAGTATTCGAACTTAAGGGCGA
AACAAAGGCAGATGCCCATATAAGCATAAAAACAGTCAAAAACTGGTATC
GTATGTGGAAAAGAAAATAAAAAAGCGATTGGTACTTTGTTATACTCGTT
ATCTTATGTATAAATGCTTAAACATTTGTGTCAAAAAAAAAAAAAAAA

RH47329.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ak6-RA 806 Ak6-RA 26..755 2..731 3650 100 Plus
Cyp301a1-RA 2057 Cyp301a1-RA 2011..2057 731..685 235 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8456288..8456680 731..339 1965 100 Minus
chr2R 21145070 chr2R 8456953..8457140 189..2 940 100 Minus
chr2R 21145070 chr2R 8456734..8456886 340..188 765 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12569015..12569407 731..339 1965 100 Minus
2R 25286936 2R 12569680..12569867 189..2 940 100 Minus
2R 25286936 2R 12569461..12569613 340..188 765 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12570214..12570606 731..339 1965 100 Minus
2R 25260384 2R 12570879..12571066 189..2 940 100 Minus
2R 25260384 2R 12570660..12570812 340..188 765 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:35:11 has no hits.

RH47329.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:35:59 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8456287..8456678 341..732 99 <- Minus
chr2R 8456734..8456885 189..340 100 <- Minus
chr2R 8456954..8457140 1..188 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:00 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
CG8816-RA 1..528 143..670 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:00:32 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..528 143..670 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:11 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..528 143..670 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:11 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
CG8816-RA 1..528 143..670 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:58 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..528 143..670 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:26:35 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
CG8816-RA 1..730 2..732 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:00:31 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..730 2..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:11 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..710 22..732 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:12 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
CG8816-RA 1..730 2..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:58 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
Ak6-RA 1..710 22..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:59 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12569014..12569405 341..732 99 <- Minus
2R 12569461..12569612 189..340 100 <- Minus
2R 12569681..12569867 1..188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:59 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12569014..12569405 341..732 99 <- Minus
2R 12569461..12569612 189..340 100 <- Minus
2R 12569681..12569867 1..188 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:59 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12569014..12569405 341..732 99 <- Minus
2R 12569461..12569612 189..340 100 <- Minus
2R 12569681..12569867 1..188 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:11 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8456519..8456910 341..732 99 <- Minus
arm_2R 8456966..8457117 189..340 100 <- Minus
arm_2R 8457186..8457372 1..188 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:00:36 Download gff for RH47329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12570213..12570604 341..732 99 <- Minus
2R 12570660..12570811 189..340 100 <- Minus
2R 12570880..12571066 1..188 99   Minus

RH47329.pep Sequence

Translation from 142 to 669

> RH47329.pep
MSEPEPDVKPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFV
EEYDEEYDCPILDEEKLMDHLEPLMAKGGNVVEYHGCDFFPERWFQAVFV
VTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEARDSYKSDIVFEL
KGETKADAHISIKTVKNWYRMWKRK*

RH47329.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11470-PA 175 GF11470-PA 1..175 1..175 804 82.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22568-PA 175 GG22568-PA 1..175 1..175 909 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19842-PA 172 GH19842-PA 5..172 8..175 787 83.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
Ak6-PA 175 CG8816-PA 1..175 1..175 949 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20430-PA 172 GI20430-PA 6..172 9..175 800 86.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21288-PA 175 GL21288-PA 1..175 1..175 810 84 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21342-PA 175 GA21342-PA 1..175 1..175 807 83.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20351-PA 175 GM20351-PA 1..175 1..175 912 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25830-PA 175 GD25830-PA 1..175 1..175 905 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20104-PA 172 GJ20104-PA 6..172 9..175 804 86.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23083-PA 170 GK23083-PA 3..169 9..175 697 72.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13438-PA 175 GE13438-PA 1..175 1..175 908 96 Plus

RH47329.hyp Sequence

Translation from 142 to 669

> RH47329.hyp
MSEPEPDVKPNILITGTPGAGKSYLCERIASELKFEWLDCSKIAKEKNFV
EEYDEEYDCPILDEEKLMDHLEPLMAKGGNVVEYHGCDFFPERWFQAVFV
VTCPNTTLYDRLKERNYNEKKLASNIQCEIFGTILEEARDSYKSDIVFEL
KGETKADAHISIKTVKNWYRMWKRK*

RH47329.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Ak6-PA 175 CG8816-PA 1..175 1..175 949 100 Plus