Clone RH47419 Report

Search the DGRC for RH47419

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:474
Well:19
Vector:pFlc-1
Associated Gene/TranscriptCG10205-RB
Protein status:RH47419.pep: gold
Preliminary Size:761
Sequenced Size:862

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10205 2001-12-17 Blastp of sequenced clone
CG10205 2002-01-01 Sim4 clustering to Release 2
CG10205 2003-01-01 Sim4 clustering to Release 3
CG10205 2008-04-29 Release 5.5 accounting
CG10205 2008-08-15 Release 5.9 accounting
CG10205 2008-12-18 5.12 accounting

Clone Sequence Records

RH47419.complete Sequence

862 bp (862 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071741

> RH47419.complete
GAGTCGTCAAACGACAGCATCCAACATCAGTCGCTAGTTGCGGAAGCCAC
AGAAGCCTCAGAATCCGCGGATACATTGTTACCTGGCTGATCTTACAAGA
TGTTCGCCAATCATCGGCTAATGCTCTTCTGCTTCTGCTTGGGTGCACTG
ACCTGGGCATCCCTCGCCATCGAAGAGTCCACGGACATTGAGGAGGATGT
GATCAGCATAGCCAACCAAACGCAGAAGGTGATCCGCGTGCATCCGCAGG
ACCTACCGCCCAAGAAAGACACCACCGGCAGCCAAATGAACTCACCCTTC
ATCCAGGTGCAAACACTGCGTCCGTCAACGGCATTCGGATCCAGTCAGCG
GCAGTACGTGGACTCCAAGCAGATGCGAAAGAGGCGCCCTCGTCCCGCCA
AGCTGCTGGGTGGAAATGTGGCCGCCAGTGAAACTCAAGCAGCAGAAGCA
ACTGAACTTGGACGCTAGGGGGGCTGGAGAGTTGTCCGCGGGGCGGCAGG
TGGAGCAGTTGAAGCAGGTGGAGGTCGGAGGTCAAGTATTACCCGTCCAG
ATGACGCCGGGCCCCTATCCCATCTACTATGTGGTGTCCAAGACCAACGG
ACGCTTCGGCAAGTTCCCCATCAAGTCGTTCCAGTCGCCCGCGGAGTTCG
CCAAATATCTGGTGAAGAGCAAAGCGGAGCCCATTGGCCGGGATCAGCGA
TTCGAGGTGATCTTGTGATCTACCCGCTCCATCTTCTCTAAGTCAAAGTT
AAAGTCTAAATTATTAGCCCCTAAACGTAGTCGTAACTATAATATTATAA
ATGCTTATTGCCGCAATAAACCCATGTCTAAAATTAGCTAATGAAACAAA
AAAAAAAAAAAA

RH47419.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG10205-RB 924 CG10205-RB 54..901 2..849 4225 99.8 Plus
CG10205.b 848 CG10205.b 2..846 2..849 4155 99.5 Plus
CG10205-RA 980 CG10205-RA 54..482 2..430 2130 99.7 Plus
CG10205-RA 980 CG10205-RA 538..957 430..849 2100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10720857..10721274 430..847 2045 99.3 Plus
chr2R 21145070 chr2R 10720494..10720801 123..430 1525 99.7 Plus
chr2R 21145070 chr2R 10720157..10720278 2..123 610 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14833534..14833953 430..849 2100 100 Plus
2R 25286936 2R 14833171..14833478 123..430 1525 99.7 Plus
2R 25286936 2R 14832834..14832955 2..123 610 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14834733..14835152 430..849 2100 100 Plus
2R 25260384 2R 14834370..14834677 123..430 1525 99.6 Plus
2R 25260384 2R 14834033..14834154 2..123 610 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:44:15 has no hits.

RH47419.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:44:57 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10720156..10720278 1..123 99 -> Plus
chr2R 10720495..10720801 124..430 99 -> Plus
chr2R 10720858..10721274 431..847 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:03 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 1..369 100..468 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:28:20 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 1..369 100..468 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:21 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 1..369 100..468 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:25:31 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 1..369 100..468 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:31 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 1..369 100..468 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:27:03 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 2..847 2..847 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:28:19 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 2..847 2..847 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:21 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 2..848 1..847 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:25:31 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 2..847 2..847 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:31 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
CG10205-RB 2..848 1..847 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:57 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14832833..14832955 1..123 99 -> Plus
2R 14833172..14833478 124..430 99 -> Plus
2R 14833535..14833951 431..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:57 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14832833..14832955 1..123 99 -> Plus
2R 14833172..14833478 124..430 99 -> Plus
2R 14833535..14833951 431..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:57 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14832833..14832955 1..123 99 -> Plus
2R 14833172..14833478 124..430 99 -> Plus
2R 14833535..14833951 431..847 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:21 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10720338..10720460 1..123 99 -> Plus
arm_2R 10720677..10720983 124..430 99 -> Plus
arm_2R 10721040..10721456 431..847 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:14 Download gff for RH47419.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14834371..14834677 124..430 99 -> Plus
2R 14834734..14835150 431..847 100   Plus
2R 14834032..14834154 1..123 99 -> Plus

RH47419.pep Sequence

Translation from 99 to 467

> RH47419.pep
MFANHRLMLFCFCLGALTWASLAIEESTDIEEDVISIANQTQKVIRVHPQ
DLPPKKDTTGSQMNSPFIQVQTLRPSTAFGSSQRQYVDSKQMRKRRPRPA
KLLGGNVAASETQAAEATELGR*

RH47419.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13137-PA 217 GF13137-PA 1..118 1..114 369 69.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20483-PA 227 GG20483-PA 1..123 1..120 516 90.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21419-PA 217 GH21419-PA 36..101 30..96 206 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG10205-PB 122 CG10205-PB 1..122 1..122 622 100 Plus
CG10205-PA 224 CG10205-PA 1..116 1..116 568 95.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18595-PA 218 GI18595-PA 1..97 1..99 206 50.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11439-PA 224 GL11439-PA 1..89 1..91 295 64.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10153-PA 224 GA10153-PA 1..89 1..91 296 64.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21574-PA 224 GM21574-PA 1..123 1..120 566 89.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11079-PA 224 GD11079-PA 1..123 1..120 555 88.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20391-PA 211 GJ20391-PA 1..89 8..96 210 53.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22915-PA 262 GK22915-PA 78..144 30..103 214 60.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13613-PA 227 GE13613-PA 1..117 1..115 557 89.7 Plus

RH47419.hyp Sequence

Translation from 99 to 467

> RH47419.hyp
MFANHRLMLFCFCLGALTWASLAIEESTDIEEDVISIANQTQKVIRVHPQ
DLPPKKDTTGSQMNSPFIQVQTLRPSTAFGSSQRQYVDSKQMRKRRPRPA
KLLGGNVAASETQAAEATELGR*

RH47419.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG10205-PB 122 CG10205-PB 1..122 1..122 622 100 Plus
CG10205-PA 224 CG10205-PA 1..116 1..116 568 95.7 Plus