BDGP Sequence Production Resources |
Search the DGRC for RH47419
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 474 |
Well: | 19 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG10205-RB |
Protein status: | RH47419.pep: gold |
Preliminary Size: | 761 |
Sequenced Size: | 862 |
Gene | Date | Evidence |
---|---|---|
CG10205 | 2001-12-17 | Blastp of sequenced clone |
CG10205 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10205 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10205 | 2008-04-29 | Release 5.5 accounting |
CG10205 | 2008-08-15 | Release 5.9 accounting |
CG10205 | 2008-12-18 | 5.12 accounting |
862 bp (862 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071741
> RH47419.complete GAGTCGTCAAACGACAGCATCCAACATCAGTCGCTAGTTGCGGAAGCCAC AGAAGCCTCAGAATCCGCGGATACATTGTTACCTGGCTGATCTTACAAGA TGTTCGCCAATCATCGGCTAATGCTCTTCTGCTTCTGCTTGGGTGCACTG ACCTGGGCATCCCTCGCCATCGAAGAGTCCACGGACATTGAGGAGGATGT GATCAGCATAGCCAACCAAACGCAGAAGGTGATCCGCGTGCATCCGCAGG ACCTACCGCCCAAGAAAGACACCACCGGCAGCCAAATGAACTCACCCTTC ATCCAGGTGCAAACACTGCGTCCGTCAACGGCATTCGGATCCAGTCAGCG GCAGTACGTGGACTCCAAGCAGATGCGAAAGAGGCGCCCTCGTCCCGCCA AGCTGCTGGGTGGAAATGTGGCCGCCAGTGAAACTCAAGCAGCAGAAGCA ACTGAACTTGGACGCTAGGGGGGCTGGAGAGTTGTCCGCGGGGCGGCAGG TGGAGCAGTTGAAGCAGGTGGAGGTCGGAGGTCAAGTATTACCCGTCCAG ATGACGCCGGGCCCCTATCCCATCTACTATGTGGTGTCCAAGACCAACGG ACGCTTCGGCAAGTTCCCCATCAAGTCGTTCCAGTCGCCCGCGGAGTTCG CCAAATATCTGGTGAAGAGCAAAGCGGAGCCCATTGGCCGGGATCAGCGA TTCGAGGTGATCTTGTGATCTACCCGCTCCATCTTCTCTAAGTCAAAGTT AAAGTCTAAATTATTAGCCCCTAAACGTAGTCGTAACTATAATATTATAA ATGCTTATTGCCGCAATAAACCCATGTCTAAAATTAGCTAATGAAACAAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10205-RB | 924 | CG10205-RB | 54..901 | 2..849 | 4225 | 99.8 | Plus |
CG10205.b | 848 | CG10205.b | 2..846 | 2..849 | 4155 | 99.5 | Plus |
CG10205-RA | 980 | CG10205-RA | 54..482 | 2..430 | 2130 | 99.7 | Plus |
CG10205-RA | 980 | CG10205-RA | 538..957 | 430..849 | 2100 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 10720857..10721274 | 430..847 | 2045 | 99.3 | Plus |
chr2R | 21145070 | chr2R | 10720494..10720801 | 123..430 | 1525 | 99.7 | Plus |
chr2R | 21145070 | chr2R | 10720157..10720278 | 2..123 | 610 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 14833534..14833953 | 430..849 | 2100 | 100 | Plus |
2R | 25286936 | 2R | 14833171..14833478 | 123..430 | 1525 | 99.7 | Plus |
2R | 25286936 | 2R | 14832834..14832955 | 2..123 | 610 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 14834733..14835152 | 430..849 | 2100 | 100 | Plus |
2R | 25260384 | 2R | 14834370..14834677 | 123..430 | 1525 | 99.6 | Plus |
2R | 25260384 | 2R | 14834033..14834154 | 2..123 | 610 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10720156..10720278 | 1..123 | 99 | -> | Plus |
chr2R | 10720495..10720801 | 124..430 | 99 | -> | Plus |
chr2R | 10720858..10721274 | 431..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 1..369 | 100..468 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 1..369 | 100..468 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 1..369 | 100..468 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 1..369 | 100..468 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 1..369 | 100..468 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 2..847 | 2..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 2..847 | 2..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 2..848 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 2..847 | 2..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10205-RB | 2..848 | 1..847 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14832833..14832955 | 1..123 | 99 | -> | Plus |
2R | 14833172..14833478 | 124..430 | 99 | -> | Plus |
2R | 14833535..14833951 | 431..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14832833..14832955 | 1..123 | 99 | -> | Plus |
2R | 14833172..14833478 | 124..430 | 99 | -> | Plus |
2R | 14833535..14833951 | 431..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14832833..14832955 | 1..123 | 99 | -> | Plus |
2R | 14833172..14833478 | 124..430 | 99 | -> | Plus |
2R | 14833535..14833951 | 431..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10720338..10720460 | 1..123 | 99 | -> | Plus |
arm_2R | 10720677..10720983 | 124..430 | 99 | -> | Plus |
arm_2R | 10721040..10721456 | 431..847 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14834371..14834677 | 124..430 | 99 | -> | Plus |
2R | 14834734..14835150 | 431..847 | 100 | Plus | |
2R | 14834032..14834154 | 1..123 | 99 | -> | Plus |
Translation from 99 to 467
> RH47419.pep MFANHRLMLFCFCLGALTWASLAIEESTDIEEDVISIANQTQKVIRVHPQ DLPPKKDTTGSQMNSPFIQVQTLRPSTAFGSSQRQYVDSKQMRKRRPRPA KLLGGNVAASETQAAEATELGR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13137-PA | 217 | GF13137-PA | 1..118 | 1..114 | 369 | 69.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20483-PA | 227 | GG20483-PA | 1..123 | 1..120 | 516 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21419-PA | 217 | GH21419-PA | 36..101 | 30..96 | 206 | 62.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10205-PB | 122 | CG10205-PB | 1..122 | 1..122 | 622 | 100 | Plus |
CG10205-PA | 224 | CG10205-PA | 1..116 | 1..116 | 568 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18595-PA | 218 | GI18595-PA | 1..97 | 1..99 | 206 | 50.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11439-PA | 224 | GL11439-PA | 1..89 | 1..91 | 295 | 64.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10153-PA | 224 | GA10153-PA | 1..89 | 1..91 | 296 | 64.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21574-PA | 224 | GM21574-PA | 1..123 | 1..120 | 566 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11079-PA | 224 | GD11079-PA | 1..123 | 1..120 | 555 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20391-PA | 211 | GJ20391-PA | 1..89 | 8..96 | 210 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22915-PA | 262 | GK22915-PA | 78..144 | 30..103 | 214 | 60.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13613-PA | 227 | GE13613-PA | 1..117 | 1..115 | 557 | 89.7 | Plus |
Translation from 99 to 467
> RH47419.hyp MFANHRLMLFCFCLGALTWASLAIEESTDIEEDVISIANQTQKVIRVHPQ DLPPKKDTTGSQMNSPFIQVQTLRPSTAFGSSQRQYVDSKQMRKRRPRPA KLLGGNVAASETQAAEATELGR*