BDGP Sequence Production Resources |
Search the DGRC for RH47995
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 479 |
Well: | 95 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpS20-RA |
Protein status: | RH47995.pep: gold |
Preliminary Size: | 527 |
Sequenced Size: | 542 |
Gene | Date | Evidence |
---|---|---|
CG15693 | 2001-12-17 | Blastp of sequenced clone |
CG15693 | 2002-01-01 | Sim4 clustering to Release 2 |
RpS20 | 2008-04-29 | Release 5.5 accounting |
RpS20 | 2008-08-15 | Release 5.9 accounting |
RpS20 | 2008-12-18 | 5.12 accounting |
542 bp (542 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071742
> RH47995.complete GCTCTCTTCGTTTTCAACCAGCAAATTGACTGGTTCAGCGCTGCTCAAAA TACAAAGATTTGAATATCTCGACCAGGGAAATTGCTAAATAATGGCTGCT GCACCCAAGGATATTGAGAAGCCCCATGTCGGCGATTCTGCCTCTGTGCA CCGCATCCGCATCACCCTGACATCCAGGAACGTGCGTTCGCTGGAGAATG TGTGCCGCGACCTGATCAACGGTGCAAAGAACCAGAACTTGCGCGTCAAG GGCCCCGTGCGCATGCCGACCAAGACCCTTCGCATCACCACCCGTAAGAC TCCTTGTGGTGAGGGTTCCAAGACCTGGGATCGCTTCCAGATGAGAATCC ACAAGCGCATCATCGACTTGCACTCGCCCTCTGAGATCGTCAAGAAGATT ACCTCCATCAACATCGAGCCCGGCGTAGAGGTTGAGGTCACCATCGCCAA CTAAGATCGGCAGATGCCACATTTTTACACCTCGAAAAGTTTGGCGTGCT AATAAAAACAAAGAACTTTTTCCATACAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS20-RA | 898 | RpS20-RA | 204..729 | 3..528 | 2630 | 100 | Plus |
RpS20.b | 580 | RpS20.b | 17..541 | 3..528 | 2575 | 99.6 | Plus |
RpS20.a | 549 | RpS20.a | 17..327 | 3..313 | 1540 | 99.6 | Plus |
RpS20.a | 549 | RpS20.a | 322..510 | 340..528 | 945 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 16647041..16647233 | 335..527 | 965 | 100 | Plus |
chr3R | 27901430 | chr3R | 16646332..16646489 | 94..251 | 790 | 100 | Plus |
chr3R | 27901430 | chr3R | 16646097..16646189 | 3..95 | 465 | 100 | Plus |
chr3R | 27901430 | chr3R | 16646715..16646806 | 249..340 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 20823126..20823319 | 335..528 | 970 | 100 | Plus |
3R | 32079331 | 3R | 20822417..20822574 | 94..251 | 790 | 100 | Plus |
3R | 32079331 | 3R | 20822182..20822274 | 3..95 | 465 | 100 | Plus |
3R | 32079331 | 3R | 20822800..20822891 | 249..340 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 20563957..20564150 | 335..528 | 970 | 100 | Plus |
3R | 31820162 | 3R | 20563248..20563405 | 94..251 | 790 | 100 | Plus |
3R | 31820162 | 3R | 20563013..20563105 | 3..95 | 465 | 100 | Plus |
3R | 31820162 | 3R | 20563631..20563722 | 249..340 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dbuz\BuT2 | 2775 | Dbuz\BuT2 BUT2 2775bp | 2540..2593 | 516..463 | 108 | 66.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 16646717..16646806 | 251..340 | 100 | -> | Plus |
chr3R | 16647047..16647233 | 341..527 | 100 | Plus | |
chr3R | 16646094..16646188 | 1..94 | 97 | -> | Plus |
chr3R | 16646333..16646488 | 95..250 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..363 | 92..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..363 | 92..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..363 | 92..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..363 | 92..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..363 | 92..454 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 2..528 | 2..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 2..528 | 2..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..526 | 3..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 2..528 | 2..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS20-RA | 1..526 | 3..527 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20822179..20822273 | 1..94 | 97 | -> | Plus |
3R | 20822418..20822573 | 95..250 | 100 | -> | Plus |
3R | 20822802..20822891 | 251..340 | 100 | -> | Plus |
3R | 20823132..20823318 | 341..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20822179..20822273 | 1..94 | 97 | -> | Plus |
3R | 20822418..20822573 | 95..250 | 100 | -> | Plus |
3R | 20822802..20822891 | 251..340 | 100 | -> | Plus |
3R | 20823132..20823318 | 341..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20822179..20822273 | 1..94 | 97 | -> | Plus |
3R | 20822418..20822573 | 95..250 | 100 | -> | Plus |
3R | 20822802..20822891 | 251..340 | 100 | -> | Plus |
3R | 20823132..20823318 | 341..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 16647901..16647995 | 1..94 | 97 | -> | Plus |
arm_3R | 16648140..16648295 | 95..250 | 100 | -> | Plus |
arm_3R | 16648524..16648613 | 251..340 | 100 | -> | Plus |
arm_3R | 16648854..16649040 | 341..527 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 20563010..20563104 | 1..94 | 97 | -> | Plus |
3R | 20563249..20563404 | 95..250 | 100 | -> | Plus |
3R | 20563633..20563722 | 251..340 | 100 | -> | Plus |
3R | 20563963..20564149 | 341..527 | 100 | Plus |
Translation from 91 to 453
> RH47995.pep MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNL RVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIV KKITSINIEPGVEVEVTIAN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17987-PA | 120 | GF17987-PA | 1..120 | 1..120 | 615 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24144-PA | 120 | GG24144-PA | 1..120 | 1..120 | 615 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15938-PA | 120 | GH15938-PA | 1..120 | 1..120 | 619 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS20-PA | 120 | CG15693-PA | 1..120 | 1..120 | 616 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22154-PA | 120 | GI22154-PA | 1..120 | 1..120 | 610 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23257-PA | 120 | GL23257-PA | 1..120 | 1..120 | 610 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13894-PA | 120 | GA13894-PA | 1..120 | 1..120 | 610 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23136-PA | 120 | GM23136-PA | 1..120 | 1..120 | 617 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19375-PA | 120 | GD19375-PA | 1..120 | 1..120 | 617 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24272-PA | 119 | GJ24272-PA | 1..119 | 2..120 | 602 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22470-PA | 126 | GK22470-PA | 8..126 | 2..120 | 608 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpS20-PA | 120 | GE25687-PA | 1..120 | 1..120 | 615 | 99.2 | Plus |
Translation from 91 to 453
> RH47995.hyp MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNL RVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIV KKITSINIEPGVEVEVTIAN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS20-PA | 120 | CG15693-PA | 1..120 | 1..120 | 616 | 100 | Plus |