Clone RH47995 Report

Search the DGRC for RH47995

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:479
Well:95
Vector:pFlc-1
Associated Gene/TranscriptRpS20-RA
Protein status:RH47995.pep: gold
Preliminary Size:527
Sequenced Size:542

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15693 2001-12-17 Blastp of sequenced clone
CG15693 2002-01-01 Sim4 clustering to Release 2
RpS20 2008-04-29 Release 5.5 accounting
RpS20 2008-08-15 Release 5.9 accounting
RpS20 2008-12-18 5.12 accounting

Clone Sequence Records

RH47995.complete Sequence

542 bp (542 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071742

> RH47995.complete
GCTCTCTTCGTTTTCAACCAGCAAATTGACTGGTTCAGCGCTGCTCAAAA
TACAAAGATTTGAATATCTCGACCAGGGAAATTGCTAAATAATGGCTGCT
GCACCCAAGGATATTGAGAAGCCCCATGTCGGCGATTCTGCCTCTGTGCA
CCGCATCCGCATCACCCTGACATCCAGGAACGTGCGTTCGCTGGAGAATG
TGTGCCGCGACCTGATCAACGGTGCAAAGAACCAGAACTTGCGCGTCAAG
GGCCCCGTGCGCATGCCGACCAAGACCCTTCGCATCACCACCCGTAAGAC
TCCTTGTGGTGAGGGTTCCAAGACCTGGGATCGCTTCCAGATGAGAATCC
ACAAGCGCATCATCGACTTGCACTCGCCCTCTGAGATCGTCAAGAAGATT
ACCTCCATCAACATCGAGCCCGGCGTAGAGGTTGAGGTCACCATCGCCAA
CTAAGATCGGCAGATGCCACATTTTTACACCTCGAAAAGTTTGGCGTGCT
AATAAAAACAAAGAACTTTTTCCATACAAAAAAAAAAAAAAA

RH47995.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-RA 898 RpS20-RA 204..729 3..528 2630 100 Plus
RpS20.b 580 RpS20.b 17..541 3..528 2575 99.6 Plus
RpS20.a 549 RpS20.a 17..327 3..313 1540 99.6 Plus
RpS20.a 549 RpS20.a 322..510 340..528 945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:34:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16647041..16647233 335..527 965 100 Plus
chr3R 27901430 chr3R 16646332..16646489 94..251 790 100 Plus
chr3R 27901430 chr3R 16646097..16646189 3..95 465 100 Plus
chr3R 27901430 chr3R 16646715..16646806 249..340 460 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20823126..20823319 335..528 970 100 Plus
3R 32079331 3R 20822417..20822574 94..251 790 100 Plus
3R 32079331 3R 20822182..20822274 3..95 465 100 Plus
3R 32079331 3R 20822800..20822891 249..340 460 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20563957..20564150 335..528 970 100 Plus
3R 31820162 3R 20563248..20563405 94..251 790 100 Plus
3R 31820162 3R 20563013..20563105 3..95 465 100 Plus
3R 31820162 3R 20563631..20563722 249..340 460 100 Plus
Blast to na_te.dros performed 2019-03-15 20:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 2540..2593 516..463 108 66.7 Minus

RH47995.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:36:00 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16646717..16646806 251..340 100 -> Plus
chr3R 16647047..16647233 341..527 100   Plus
chr3R 16646094..16646188 1..94 97 -> Plus
chr3R 16646333..16646488 95..250 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:16 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..363 92..454 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:27:03 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..363 92..454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:08 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..363 92..454 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:47 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..363 92..454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:24:33 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..363 92..454 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:55 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 2..528 2..527 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:27:02 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 2..528 2..527 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:08 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..526 3..527 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:48 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 2..528 2..527 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:24:33 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 1..526 3..527 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:00 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20822179..20822273 1..94 97 -> Plus
3R 20822418..20822573 95..250 100 -> Plus
3R 20822802..20822891 251..340 100 -> Plus
3R 20823132..20823318 341..527 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:00 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20822179..20822273 1..94 97 -> Plus
3R 20822418..20822573 95..250 100 -> Plus
3R 20822802..20822891 251..340 100 -> Plus
3R 20823132..20823318 341..527 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:00 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20822179..20822273 1..94 97 -> Plus
3R 20822418..20822573 95..250 100 -> Plus
3R 20822802..20822891 251..340 100 -> Plus
3R 20823132..20823318 341..527 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:08 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16647901..16647995 1..94 97 -> Plus
arm_3R 16648140..16648295 95..250 100 -> Plus
arm_3R 16648524..16648613 251..340 100 -> Plus
arm_3R 16648854..16649040 341..527 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:50:53 Download gff for RH47995.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20563010..20563104 1..94 97 -> Plus
3R 20563249..20563404 95..250 100 -> Plus
3R 20563633..20563722 251..340 100 -> Plus
3R 20563963..20564149 341..527 100   Plus

RH47995.pep Sequence

Translation from 91 to 453

> RH47995.pep
MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNL
RVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIV
KKITSINIEPGVEVEVTIAN*

RH47995.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17987-PA 120 GF17987-PA 1..120 1..120 615 99.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24144-PA 120 GG24144-PA 1..120 1..120 615 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15938-PA 120 GH15938-PA 1..120 1..120 619 99.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-PA 120 CG15693-PA 1..120 1..120 616 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22154-PA 120 GI22154-PA 1..120 1..120 610 98.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23257-PA 120 GL23257-PA 1..120 1..120 610 98.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13894-PA 120 GA13894-PA 1..120 1..120 610 98.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23136-PA 120 GM23136-PA 1..120 1..120 617 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19375-PA 120 GD19375-PA 1..120 1..120 617 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:04:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24272-PA 119 GJ24272-PA 1..119 2..120 602 98.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22470-PA 126 GK22470-PA 8..126 2..120 608 98.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS20-PA 120 GE25687-PA 1..120 1..120 615 99.2 Plus

RH47995.hyp Sequence

Translation from 91 to 453

> RH47995.hyp
MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNL
RVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIV
KKITSINIEPGVEVEVTIAN*

RH47995.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-PA 120 CG15693-PA 1..120 1..120 616 100 Plus