Clone RH48056 Report

Search the DGRC for RH48056

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:480
Well:56
Vector:pFlc-1
Associated Gene/TranscriptRpL34b-RA
Protein status:RH48056.pep: gold
Preliminary Size:771
Sequenced Size:667

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9354 2002-01-01 Sim4 clustering to Release 2
CG9354 2002-02-27 Blastp of sequenced clone
CG9354 2003-01-01 Sim4 clustering to Release 3
RpL34b 2008-04-29 Release 5.5 accounting
RpL34b 2008-08-15 Release 5.9 accounting
RpL34b 2008-12-18 5.12 accounting

Clone Sequence Records

RH48056.complete Sequence

667 bp (667 high quality bases) assembled on 2002-02-27

GenBank Submission: AY089676

> RH48056.complete
GAAGTTCACGTCGTGCGCGAACAGGGTTGCCACCTTTCTTTCTAGTTTCG
TCTCTTTGAGCAACAACAACAGCAAAATGGTCCAACGTCTGACGCTCCGG
AGACGCCTGTCCTACAACACACGCTCCAACAAGCGGCGCATTGTTCGCAC
GCCCGGTGGTCGTCTGGTTTACCAGTATGTGAAGAAGAACCCCACCGTGC
CCCGTTGCGGCCAGTGCAAGGAGAAGTTGAAGGGTATCACCCCCTCCCGC
CCCAGCGAGCGCCCCCGCATGTCCAAGCGCCTGAAGACCGTGTCCAGGAC
CTACGGTGGAGTGCTGTGCCACAGCTGCCTGCGCGAGCGTATCGTGCGCG
CCTTCCTCATCGAGGAGCAGAAGATCGTCAAGGCCCTGAAGAGCCAGCGC
GAGGCGCTCGTCAAGCCGGTGAAGGCCCCCAAGGCCAAGCCCGAGCCCAA
GAAGAAGCCCGCTGCTGGAGCCAAGGGAACCAAGGCCGGTGCCGGCAAGG
TCACCAAGGGTGGTGCTGGCGCCAAGGGAGCCGCTGGCAAGAAGCCCGGC
CAGAAGCCAGCCGCTGGCAAGCCCAGGAAGTAAACAGCCCACGCAACGAG
TTCGGTGTACTGCTAAATAACTTTTAAAATAAATTGGTTTTTTCCAACTG
GAAAAAAAAAAAAAAAA

RH48056.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34b-RB 883 RpL34b-RB 87..737 2..652 3255 100 Plus
RpL34b.a 803 RpL34b.a 36..689 2..652 3200 99.5 Plus
RpL34b-RA 991 RpL34b-RA 252..845 59..652 2970 100 Plus
RpL34b-RA 991 RpL34b-RA 22..80 2..60 295 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5226202..5226711 651..142 2550 100 Minus
chr3R 27901430 chr3R 21881621..21881903 424..142 830 86.2 Minus
chr3R 27901430 chr3R 5226775..5226857 141..59 415 100 Minus
chr3R 27901430 chr3R 5227029..5227087 60..2 295 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9400368..9400878 652..142 2555 100 Minus
3R 32079331 3R 26058635..26058917 424..142 830 86.2 Minus
3R 32079331 3R 9400942..9401024 141..59 415 100 Minus
3R 32079331 3R 9401196..9401254 60..2 295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9141199..9141709 652..142 2555 100 Minus
3R 31820162 3R 25799466..25799748 424..142 830 86.2 Minus
3R 31820162 3R 9141773..9141855 141..59 415 100 Minus
3R 31820162 3R 9142027..9142085 60..2 295 100 Minus
3R 31820162 3R 25799811..25799878 141..74 175 83.8 Minus
Blast to na_te.dros performed on 2019-03-16 13:07:17 has no hits.

RH48056.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:08:02 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5226775..5226855 61..141 100 <- Minus
chr3R 5227029..5227087 1..60 98   Minus
chr3R 5226202..5226711 142..651 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:18 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RA 1..507 77..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:32:06 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RA 1..507 77..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:16:28 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RA 1..507 77..583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:05 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RA 1..507 77..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:14:44 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RA 1..507 77..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:58:04 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RB 2..652 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:32:06 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RB 2..652 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:16:28 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RB 1..622 30..651 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:05 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RB 2..652 1..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:44 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
RpL34b-RB 1..622 30..651 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:08:02 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9400369..9400878 142..651 100 <- Minus
3R 9400942..9401022 61..141 100 <- Minus
3R 9401196..9401254 1..60 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:08:02 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9400369..9400878 142..651 100 <- Minus
3R 9400942..9401022 61..141 100 <- Minus
3R 9401196..9401254 1..60 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:08:02 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9400369..9400878 142..651 100 <- Minus
3R 9400942..9401022 61..141 100 <- Minus
3R 9401196..9401254 1..60 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:16:28 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5226091..5226600 142..651 100 <- Minus
arm_3R 5226664..5226744 61..141 100 <- Minus
arm_3R 5226918..5226976 1..60 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:54 Download gff for RH48056.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9141200..9141709 142..651 100 <- Minus
3R 9141773..9141853 61..141 100 <- Minus
3R 9142027..9142085 1..60 98   Minus

RH48056.hyp Sequence

Translation from 0 to 582

> RH48056.hyp
KFTSCANRVATFLSSFVSLSNNNSKMVQRLTLRRRLSYNTRSNKRRIVRT
PGGRLVYQYVKKNPTVPRCGQCKEKLKGITPSRPSERPRMSKRLKTVSRT
YGGVLCHSCLRERIVRAFLIEEQKIVKALKSQREALVKPVKAPKAKPEPK
KKPAAGAKGTKAGAGKVTKGGAGAKGAAGKKPGQKPAAGKPRK*

RH48056.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34b-PD 168 CG9354-PD 1..168 26..193 864 100 Plus
RpL34b-PC 168 CG9354-PC 1..168 26..193 864 100 Plus
RpL34b-PA 168 CG9354-PA 1..168 26..193 864 100 Plus
RpL34b-PB 168 CG9354-PB 1..168 26..193 864 100 Plus
RpL34a-PC 162 CG6090-PC 1..153 26..187 618 82.7 Plus

RH48056.pep Sequence

Translation from 76 to 582

> RH48056.pep
MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEK
LKGITPSRPSERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKI
VKALKSQREALVKPVKAPKAKPEPKKKPAAGAKGTKAGAGKVTKGGAGAK
GAAGKKPGQKPAAGKPRK*

RH48056.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17768-PA 167 GF17768-PA 1..115 1..115 560 95.7 Plus
Dana\GF18218-PA 157 GF18218-PA 1..110 1..110 535 93.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17378-PA 168 GG17378-PA 1..168 1..168 832 100 Plus
Dere\GG12199-PA 162 GG12199-PA 1..111 1..111 567 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18140-PA 158 GH18140-PA 1..111 1..111 549 96.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
RpL34b-PD 168 CG9354-PD 1..168 1..168 864 100 Plus
RpL34b-PC 168 CG9354-PC 1..168 1..168 864 100 Plus
RpL34b-PA 168 CG9354-PA 1..168 1..168 864 100 Plus
RpL34b-PB 168 CG9354-PB 1..168 1..168 864 100 Plus
RpL34a-PC 162 CG6090-PC 1..153 1..162 618 82.7 Plus
RpL34a-PB 162 CG6090-PB 1..153 1..162 618 82.7 Plus
RpL34a-PA 162 CG6090-PA 1..153 1..162 618 82.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22901-PA 158 GI22901-PA 1..153 1..162 554 76.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13673-PA 170 GL13673-PA 1..170 1..168 603 77.8 Plus
Dper\GL22011-PA 159 GL22011-PA 1..152 1..160 567 82.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26986-PA 170 GA26986-PA 1..170 1..168 603 77.8 Plus
Dpse\GA27345-PA 159 GA27345-PA 1..152 1..160 567 82.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23916-PA 130 GM23916-PA 1..130 1..130 655 99.2 Plus
Dsec\GM26264-PA 164 GM26264-PA 1..164 1..168 610 93.5 Plus
Dsec\GM10197-PA 162 GM10197-PA 1..111 1..111 561 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20801-PA 168 GD20801-PA 1..168 1..168 825 98.8 Plus
Dsim\GD18147-PA 162 GD18147-PA 1..111 1..111 566 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23314-PA 158 GJ23314-PA 1..154 1..163 556 77.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12799-PA 165 GK12799-PA 1..165 1..168 566 76.8 Plus
Dwil\GK12136-PA 171 GK12136-PA 1..115 1..115 563 96.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24782-PA 168 GE24782-PA 1..168 1..168 824 99.4 Plus
Dyak\GE10642-PA 162 GE10642-PA 1..111 1..111 566 98.2 Plus