Clone RH48239 Report

Search the DGRC for RH48239

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:482
Well:39
Vector:pFlc-1
Associated Gene/TranscriptArpc5-RA
Protein status:RH48239.pep: gold
Preliminary Size:750
Sequenced Size:801

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9881 2002-01-01 Sim4 clustering to Release 2
CG9881 2002-02-27 Blastp of sequenced clone
CG9881 2003-01-01 Sim4 clustering to Release 3
p16-ARC 2008-04-29 Release 5.5 accounting
p16-ARC 2008-08-15 Release 5.9 accounting
p16-ARC 2008-12-18 5.12 accounting

Clone Sequence Records

RH48239.complete Sequence

801 bp (801 high quality bases) assembled on 2002-02-27

GenBank Submission: AY089678

> RH48239.complete
GCCTCATCTGTTTTGCCTTGCCGGATTTTGTGATTCATATTTTTGTAGAG
AAAAGTGGTGGGAATTTAGCGAAAACATGGCCAAAAACACGTCCAGCAAC
GCGTTCCGCAAGATCGATGTGGACCAGTACAATGAGGACAACTTCCGGGA
GGATGATGGGGTGGAGAGCGCGGCAGCCGGTCCGGATGAGAGCGAGATTA
CGACGCTGCTGACGCAGGGAAAATCCGTGGAGGCGCTCCTGAGTGCGCTG
CAGAATGCCCCGCTGCGCTGCAAGAACCAGAATGTGAAGGACCACGCCCT
GAACATCACGCTGCGGGTGCTGCTGTCCATCAAGTCGACGCAAATGGACC
AGGCCATCGACACCTTGGACCAGAACGACCTAATAGACGTGCTGATGAAG
TACATATATCGGGGATTCGAGATCCCCTCGGAGGGCTCCAGTGGCCACCT
GCTGCAGTGGCATGAGAAGGCCTTCGCCAAGGGAGGAGTGGGCTGCATTG
TCCGCGTGCTGTCCGACACAAATCGCGCCTAGAGGAGATCAGCACAGCCA
AAGGCGGTCATAGAGTCACTACCCCAACTGTTCCCTGCCCCATAAACCGA
TTCATACGCATCGCGGAGCATTTAATCAACACAGGATTGGAGCACTGGAC
ACCACATCCTTATCTTCGGGATTTGCCACGCCCCAGCTGGAACCCACTTC
TGTTTCTTCGCCGCAATACAAATGACGTTTTCCAAATTAGATTTTAACTG
GTATCCAAGTATTAAAGTTTTTATTACGAAAGGTCAAAAAAAAAAAAAAA
A

RH48239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
p16-ARC-RA 1076 p16-ARC-RA 145..926 3..784 3910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2580447..2580943 288..784 2410 99 Plus
chr2L 23010047 chr2L 2580102..2580387 5..290 1415 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2580642..2581138 288..784 2485 100 Plus
2L 23513712 2L 2580295..2580582 3..290 1440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2580642..2581138 288..784 2485 100 Plus
2L 23513712 2L 2580295..2580582 3..290 1440 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:11:55 has no hits.

RH48239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:07 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2580096..2580386 1..289 98 -> Plus
chr2L 2580449..2580943 290..785 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:21 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..456 77..532 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:32:09 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..456 77..532 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc5-RA 1..456 77..532 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..456 77..532 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:00:44 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc5-RA 1..456 77..532 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:58:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..762 1..760 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:32:08 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..762 1..760 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc5-RA 2..785 2..784 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
p16-ARC-RA 1..762 1..760 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:00:44 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc5-RA 2..785 2..784 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:07 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2580644..2581138 290..785 99   Plus
2L 2580291..2580581 1..289 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:07 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2580644..2581138 290..785 99   Plus
2L 2580291..2580581 1..289 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:07 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2580644..2581138 290..785 99   Plus
2L 2580291..2580581 1..289 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:06 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2580291..2580581 1..289 99 -> Plus
arm_2L 2580644..2581138 290..785 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:38:55 Download gff for RH48239.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2580291..2580581 1..289 99 -> Plus
2L 2580644..2581138 290..785 99   Plus

RH48239.hyp Sequence

Translation from 0 to 531

> RH48239.hyp
ATHLFCLAGFCDSYFCREKWWEFSENMAKNTSSNAFRKIDVDQYNEDNFR
EDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLRCKNQNVKDHA
LNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGH
LLQWHEKAFAKGGVGCIVRVLSDTNRA*

RH48239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc5-PB 151 CG9881-PB 1..151 27..177 767 100 Plus
Arpc5-PA 151 CG9881-PA 1..151 27..177 767 100 Plus

RH48239.pep Sequence

Translation from 76 to 531

> RH48239.pep
MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQGKS
VEALLSALQNAPLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQN
DLIDVLMKYIYRGFEIPSEGSSGHLLQWHEKAFAKGGVGCIVRVLSDTNR
A*

RH48239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20591-PA 151 GF20591-PA 1..151 1..151 792 98 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24865-PA 151 GG24865-PA 1..151 1..151 792 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11156-PA 151 GH11156-PA 1..151 1..151 742 90.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc5-PB 151 CG9881-PB 1..151 1..151 767 100 Plus
Arpc5-PA 151 CG9881-PA 1..151 1..151 767 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17862-PA 151 GI17862-PA 1..151 1..151 750 92.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26566-PA 133 GL26566-PA 16..133 34..151 601 94.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22095-PA 151 GA22095-PA 1..151 1..151 765 94.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18347-PA 151 GM18347-PA 1..151 1..151 799 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23162-PA 151 GD23162-PA 1..151 1..151 799 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:53:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17361-PA 151 GJ17361-PA 1..151 1..151 731 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24566-PA 151 GK24566-PA 1..151 1..151 765 94 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18163-PA 151 GE18163-PA 1..151 1..151 799 99.3 Plus