Clone RH48588 Report

Search the DGRC for RH48588

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:485
Well:88
Vector:pFlc-1
Associated Gene/TranscriptCG30185-RA
Protein status:RH48588.pep: gold
Preliminary Size:1668
Sequenced Size:737

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5365 2002-01-01 Sim4 clustering to Release 2
CG30185 2002-06-11 Blastp of sequenced clone
CG30185 2003-01-01 Sim4 clustering to Release 3
CG30185 2008-04-29 Release 5.5 accounting
CG30185 2008-08-15 Release 5.9 accounting
CG30185 2008-12-18 5.12 accounting

Clone Sequence Records

RH48588.complete Sequence

737 bp (737 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071743

> RH48588.complete
GATTATCGTTTCTTGCAATTTCGCACGCCAAACACAATAACTTTAATTTC
GCTGACCATGTGTGACGTTGCAACAGTGCAGAAGATAGCAAACTGCCTGG
GCGTTAATCCCGGCAAGGTGCAGCTGAACGAGGAGCAGGTCGTAACGCGC
ACGAGTGGGCAAAAGAAGAGCGTGGCCGGATTCGCCTCGATCCTGGAGAG
CCTGGCCAGCGAGTCCAAGTCGGAGACCGCCCAGAACAGCAGGGCGTCGC
GGGAGGTGGAAGCCCAGGTGTACCAGTGGATCGAGTTCTCCGTGCTCTAC
GTGGCGCCCGGCTCCAAGGACAAGTACGTGTCCAAGCAGCTTCTGGCGGA
CTTCAACAAACTGTTTGCCAGCAAATCCTACCTGGTGGGCCACTTCATCA
CTCTAGCCGACCTGGCCGTCTACTATGCCATCTACGATCTTGTGAAATCC
CTTTCGCCGGTGGACAAGGAGGTATATTTGAATCTCTCCCGCTGGTTCGA
TCACCTCCAGAATCGCGCGGATGTGCACCAGGGCGAGCCACTGCTGAACT
TCACCACCATCTACCTGCACGGCTGGGCCACAGGCACCCACATCTAAGCC
CCGGGCGGGCACCCTTGCATCCATTCACATCCAGTCACGAATGCGACACT
TAAGTTATTTATTTCTATTGCATTTCACAATGTAGTTTTGTGTGTTGTGA
TTATCATTTAATGCCAATGAGAAAAAAAAAAAAAAAA

RH48588.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG30185-RA 910 CG30185-RA 98..818 2..722 3605 100 Plus
wmd-RA 1855 wmd-RA 1690..1855 722..557 830 100 Minus
wmd.a 1180 wmd.a 1097..1180 722..639 420 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19430579..19430886 137..444 1510 99.4 Plus
chr2R 21145070 chr2R 19430957..19431234 444..721 1390 100 Plus
chr2R 21145070 chr2R 19430376..19430514 2..140 680 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23544246..23544553 137..444 1540 100 Plus
2R 25286936 2R 23544624..23544902 444..722 1395 100 Plus
2R 25286936 2R 23544043..23544181 2..140 695 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23545445..23545752 137..444 1540 100 Plus
2R 25260384 2R 23545823..23546101 444..722 1395 100 Plus
2R 25260384 2R 23545242..23545380 2..140 695 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:44:18 has no hits.

RH48588.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:44:59 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19430374..19430512 1..138 98 -> Plus
chr2R 19430581..19430886 139..444 99 -> Plus
chr2R 19430958..19431234 445..721 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:27 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..540 58..597 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:51:03 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..540 58..597 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:24 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..540 58..597 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:33:17 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..540 58..597 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:32 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..540 58..597 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:02:09 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..720 1..719 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:51:02 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..720 1..719 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:24 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 18..739 1..721 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:33:17 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 1..720 1..719 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:32 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
CG30185-RA 18..739 1..721 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:59 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23544625..23544901 445..721 100   Plus
2R 23544041..23544179 1..138 99 -> Plus
2R 23544248..23544553 139..444 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:59 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23544625..23544901 445..721 100   Plus
2R 23544041..23544179 1..138 99 -> Plus
2R 23544248..23544553 139..444 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:59 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23544625..23544901 445..721 100   Plus
2R 23544041..23544179 1..138 99 -> Plus
2R 23544248..23544553 139..444 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:24 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19431564..19431702 1..138 99 -> Plus
arm_2R 19431771..19432076 139..444 100 -> Plus
arm_2R 19432148..19432424 445..721 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:13:57 Download gff for RH48588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23545465..23545770 139..444 100 -> Plus
2R 23545842..23546118 445..721 100   Plus
2R 23545258..23545396 1..138 99 -> Plus

RH48588.hyp Sequence

Translation from 0 to 596

> RH48588.hyp
YYRFLQFRTPNTITLISLTMCDVATVQKIANCLGVNPGKVQLNEEQVVTR
TSGQKKSVAGFASILESLASESKSETAQNSRASREVEAQVYQWIEFSVLY
VAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLVKS
LSPVDKEVYLNLSRWFDHLQNRADVHQGEPLLNFTTIYLHGWATGTHI*

RH48588.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:51:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG30185-PA 179 CG30185-PA 1..179 20..198 917 100 Plus

RH48588.pep Sequence

Translation from 57 to 596

> RH48588.pep
MCDVATVQKIANCLGVNPGKVQLNEEQVVTRTSGQKKSVAGFASILESLA
SESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFN
KLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL
QNRADVHQGEPLLNFTTIYLHGWATGTHI*

RH48588.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13062-PA 179 GF13062-PA 1..179 1..179 901 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22864-PA 179 GG22864-PA 1..179 1..179 940 98.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21448-PA 179 GH21448-PA 1..179 1..179 830 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
AIMP3-PA 179 CG30185-PA 1..179 1..179 917 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19925-PA 179 GI19925-PA 1..179 1..179 780 80.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16868-PA 179 GL16868-PA 1..179 1..179 869 89.9 Plus
Dper\GL21625-PA 87 GL21625-PA 42..78 35..71 133 78.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15709-PA 179 GA15709-PA 1..179 1..179 878 91.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16023-PA 179 GM16023-PA 1..179 1..179 932 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11773-PA 179 GD11773-PA 1..179 1..179 938 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15092-PA 179 GJ15092-PA 1..179 1..179 831 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23190-PA 178 GK23190-PA 1..178 1..179 799 83.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14300-PA 179 GE14300-PA 1..179 1..179 936 97.8 Plus