BDGP Sequence Production Resources |
Search the DGRC for RH48588
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 485 |
Well: | 88 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG30185-RA |
Protein status: | RH48588.pep: gold |
Preliminary Size: | 1668 |
Sequenced Size: | 737 |
Gene | Date | Evidence |
---|---|---|
CG5365 | 2002-01-01 | Sim4 clustering to Release 2 |
CG30185 | 2002-06-11 | Blastp of sequenced clone |
CG30185 | 2003-01-01 | Sim4 clustering to Release 3 |
CG30185 | 2008-04-29 | Release 5.5 accounting |
CG30185 | 2008-08-15 | Release 5.9 accounting |
CG30185 | 2008-12-18 | 5.12 accounting |
737 bp (737 high quality bases) assembled on 2002-06-11
GenBank Submission: AY071743
> RH48588.complete GATTATCGTTTCTTGCAATTTCGCACGCCAAACACAATAACTTTAATTTC GCTGACCATGTGTGACGTTGCAACAGTGCAGAAGATAGCAAACTGCCTGG GCGTTAATCCCGGCAAGGTGCAGCTGAACGAGGAGCAGGTCGTAACGCGC ACGAGTGGGCAAAAGAAGAGCGTGGCCGGATTCGCCTCGATCCTGGAGAG CCTGGCCAGCGAGTCCAAGTCGGAGACCGCCCAGAACAGCAGGGCGTCGC GGGAGGTGGAAGCCCAGGTGTACCAGTGGATCGAGTTCTCCGTGCTCTAC GTGGCGCCCGGCTCCAAGGACAAGTACGTGTCCAAGCAGCTTCTGGCGGA CTTCAACAAACTGTTTGCCAGCAAATCCTACCTGGTGGGCCACTTCATCA CTCTAGCCGACCTGGCCGTCTACTATGCCATCTACGATCTTGTGAAATCC CTTTCGCCGGTGGACAAGGAGGTATATTTGAATCTCTCCCGCTGGTTCGA TCACCTCCAGAATCGCGCGGATGTGCACCAGGGCGAGCCACTGCTGAACT TCACCACCATCTACCTGCACGGCTGGGCCACAGGCACCCACATCTAAGCC CCGGGCGGGCACCCTTGCATCCATTCACATCCAGTCACGAATGCGACACT TAAGTTATTTATTTCTATTGCATTTCACAATGTAGTTTTGTGTGTTGTGA TTATCATTTAATGCCAATGAGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19430579..19430886 | 137..444 | 1510 | 99.4 | Plus |
chr2R | 21145070 | chr2R | 19430957..19431234 | 444..721 | 1390 | 100 | Plus |
chr2R | 21145070 | chr2R | 19430376..19430514 | 2..140 | 680 | 99.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23544246..23544553 | 137..444 | 1540 | 100 | Plus |
2R | 25286936 | 2R | 23544624..23544902 | 444..722 | 1395 | 100 | Plus |
2R | 25286936 | 2R | 23544043..23544181 | 2..140 | 695 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23545445..23545752 | 137..444 | 1540 | 100 | Plus |
2R | 25260384 | 2R | 23545823..23546101 | 444..722 | 1395 | 100 | Plus |
2R | 25260384 | 2R | 23545242..23545380 | 2..140 | 695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19430374..19430512 | 1..138 | 98 | -> | Plus |
chr2R | 19430581..19430886 | 139..444 | 99 | -> | Plus |
chr2R | 19430958..19431234 | 445..721 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..540 | 58..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..540 | 58..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..540 | 58..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..540 | 58..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..540 | 58..597 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..720 | 1..719 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..720 | 1..719 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 18..739 | 1..721 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 1..720 | 1..719 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG30185-RA | 18..739 | 1..721 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23544625..23544901 | 445..721 | 100 | Plus | |
2R | 23544041..23544179 | 1..138 | 99 | -> | Plus |
2R | 23544248..23544553 | 139..444 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23544625..23544901 | 445..721 | 100 | Plus | |
2R | 23544041..23544179 | 1..138 | 99 | -> | Plus |
2R | 23544248..23544553 | 139..444 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23544625..23544901 | 445..721 | 100 | Plus | |
2R | 23544041..23544179 | 1..138 | 99 | -> | Plus |
2R | 23544248..23544553 | 139..444 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19431564..19431702 | 1..138 | 99 | -> | Plus |
arm_2R | 19431771..19432076 | 139..444 | 100 | -> | Plus |
arm_2R | 19432148..19432424 | 445..721 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23545465..23545770 | 139..444 | 100 | -> | Plus |
2R | 23545842..23546118 | 445..721 | 100 | Plus | |
2R | 23545258..23545396 | 1..138 | 99 | -> | Plus |
Translation from 0 to 596
> RH48588.hyp YYRFLQFRTPNTITLISLTMCDVATVQKIANCLGVNPGKVQLNEEQVVTR TSGQKKSVAGFASILESLASESKSETAQNSRASREVEAQVYQWIEFSVLY VAPGSKDKYVSKQLLADFNKLFASKSYLVGHFITLADLAVYYAIYDLVKS LSPVDKEVYLNLSRWFDHLQNRADVHQGEPLLNFTTIYLHGWATGTHI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG30185-PA | 179 | CG30185-PA | 1..179 | 20..198 | 917 | 100 | Plus |
Translation from 57 to 596
> RH48588.pep MCDVATVQKIANCLGVNPGKVQLNEEQVVTRTSGQKKSVAGFASILESLA SESKSETAQNSRASREVEAQVYQWIEFSVLYVAPGSKDKYVSKQLLADFN KLFASKSYLVGHFITLADLAVYYAIYDLVKSLSPVDKEVYLNLSRWFDHL QNRADVHQGEPLLNFTTIYLHGWATGTHI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13062-PA | 179 | GF13062-PA | 1..179 | 1..179 | 901 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22864-PA | 179 | GG22864-PA | 1..179 | 1..179 | 940 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21448-PA | 179 | GH21448-PA | 1..179 | 1..179 | 830 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
AIMP3-PA | 179 | CG30185-PA | 1..179 | 1..179 | 917 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19925-PA | 179 | GI19925-PA | 1..179 | 1..179 | 780 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16868-PA | 179 | GL16868-PA | 1..179 | 1..179 | 869 | 89.9 | Plus |
Dper\GL21625-PA | 87 | GL21625-PA | 42..78 | 35..71 | 133 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15709-PA | 179 | GA15709-PA | 1..179 | 1..179 | 878 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16023-PA | 179 | GM16023-PA | 1..179 | 1..179 | 932 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11773-PA | 179 | GD11773-PA | 1..179 | 1..179 | 938 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15092-PA | 179 | GJ15092-PA | 1..179 | 1..179 | 831 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23190-PA | 178 | GK23190-PA | 1..178 | 1..179 | 799 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14300-PA | 179 | GE14300-PA | 1..179 | 1..179 | 936 | 97.8 | Plus |