BDGP Sequence Production Resources |
Search the DGRC for RH48605
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 486 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG34423-RA |
Protein status: | RH48605.pep: gold |
Sequenced Size: | 360 |
Gene | Date | Evidence |
---|---|---|
CG34423 | 2009-06-08 | Manual selection by Joe Carlson |
CG34423 | 2011-03-01 | Transcript Validation |
360 bp assembled on 2009-08-11
GenBank Submission: BT099553.1
> RH48605.complete GAGTCAGCGCTGGTATCCCAAGCAGATTCAGCACTTGAAGATGTCGCAGA TCGGAGAACTGGGCAGTGGAGCCGGCAACGGCGGCGGCGGCGGCGGATCC ATCCGGGAGGCGGGCGGTTCATTTGGCAAAATGGAGGCTGCTCGCGAGGA GGAGTTCTTCTACAAGCAGCAAAAGGAGCAACTGAAGAACCTGAAGACCA AGACGGAGCCTAAGGCACCAGAGGCTCCCAAGAAGTGAGCCCAACCAGGA GCTTTGAACTCCACTAGCTTAACTATGGTTAGGCTGGATTGTCTGAATTG TATTTAATGGGAATGGTACTCCAAATATATTTTGTTTAATTTACAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 19245342..19245520 | 166..344 | 895 | 100 | Plus |
chr2R | 21145070 | chr2R | 19245147..19245285 | 31..169 | 695 | 100 | Plus |
chr2R | 21145070 | chr2R | 19268936..19269040 | 166..62 | 270 | 83.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 23359028..23359208 | 166..346 | 905 | 100 | Plus |
2R | 25286936 | 2R | 23358833..23358971 | 31..169 | 695 | 100 | Plus |
2R | 25286936 | 2R | 23382618..23382722 | 166..62 | 270 | 83.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 23360227..23360407 | 166..346 | 905 | 100 | Plus |
2R | 25260384 | 2R | 23360032..23360170 | 31..169 | 695 | 100 | Plus |
2R | 25260384 | 2R | 23383817..23383921 | 166..62 | 270 | 83.8 | Minus |
2R | 25260384 | 2R | 23359938..23359967 | 2..31 | 150 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 19245052..19245081 | 1..30 | 96 | -> | Plus |
chr2R | 19245147..19245285 | 31..169 | 74 | -> | Plus |
chr2R | 19245346..19245520 | 170..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RA | 1..198 | 41..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 21..258 | 1..238 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 21..258 | 1..238 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 21..258 | 1..238 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RA | 76..389 | 31..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 21..364 | 1..344 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 127..468 | 1..342 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34423-RB | 127..468 | 1..342 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23358833..23358971 | 31..169 | 100 | -> | Plus |
2R | 23359032..23359206 | 170..344 | 100 | Plus | |
2R | 23358738..23358767 | 1..30 | 96 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23358833..23358971 | 31..169 | 100 | -> | Plus |
2R | 23359032..23359206 | 170..344 | 100 | Plus | |
2R | 23358738..23358767 | 1..30 | 96 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23358833..23358971 | 31..169 | 100 | -> | Plus |
2R | 23359032..23359206 | 170..344 | 100 | Plus | |
2R | 23358738..23358767 | 1..30 | 96 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 19246261..19246290 | 1..30 | 96 | -> | Plus |
arm_2R | 19246356..19246494 | 31..169 | 100 | -> | Plus |
arm_2R | 19246555..19246729 | 170..344 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 23359955..23359984 | 1..30 | 96 | -> | Plus |
2R | 23360050..23360188 | 31..169 | 100 | -> | Plus |
2R | 23360249..23360423 | 170..344 | 100 | Plus |
Translation from 0 to 237
> RH48605.hyp SQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREE EFFYKQQKEQLKNLKTKTEPKAPEAPKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34423-PB | 85 | CG34423-PB | 8..85 | 1..78 | 411 | 100 | Plus |
CG34423-PA | 65 | CG34423-PA | 1..65 | 14..78 | 336 | 100 | Plus |
CG13551-PB | 107 | CG13551-PB | 8..74 | 1..65 | 240 | 70.1 | Plus |
CG13551-PA | 107 | CG13551-PA | 8..74 | 1..65 | 240 | 70.1 | Plus |
Translation from 1 to 237
> RH48605.pep SQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREE EFFYKQQKEQLKNLKTKTEPKAPEAPKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13139-PA | 82 | GF13139-PA | 1..64 | 14..77 | 226 | 89.1 | Plus |
Dana\GF13051-PA | 106 | GF13051-PA | 7..74 | 1..66 | 165 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22845-PA | 81 | GG22845-PA | 1..65 | 14..78 | 239 | 95.4 | Plus |
Dere\GG20040-PA | 107 | GG20040-PA | 10..75 | 3..66 | 162 | 71.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20343-PA | 65 | GH20343-PA | 1..65 | 14..78 | 198 | 83.1 | Plus |
Dgri\GH20671-PA | 106 | GH20671-PA | 8..74 | 1..66 | 164 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34423-PB | 85 | CG34423-PB | 8..85 | 1..78 | 411 | 100 | Plus |
CG34423-PA | 65 | CG34423-PA | 1..65 | 14..78 | 336 | 100 | Plus |
CG13551-PB | 107 | CG13551-PB | 8..74 | 1..65 | 240 | 70.1 | Plus |
CG13551-PA | 107 | CG13551-PA | 8..74 | 1..65 | 240 | 70.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20012-PA | 85 | GI20012-PA | 8..85 | 1..78 | 275 | 84.6 | Plus |
Dmoj\GI19031-PA | 107 | GI19031-PA | 10..75 | 3..66 | 162 | 71.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11441-PA | 227 | GL11441-PA | 1..65 | 14..78 | 217 | 89.2 | Plus |
Dper\GL16907-PA | 106 | GL16907-PA | 10..74 | 3..66 | 160 | 73.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12357-PA | 106 | GA12357-PA | 10..74 | 3..66 | 160 | 73.8 | Plus |
Dpse\GA12357-PB | 86 | GA12357-PB | 3..54 | 15..66 | 145 | 80.8 | Plus |
Dpse\GA10745-PA | 244 | GA10745-PA | 1..74 | 14..78 | 145 | 63.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16002-PA | 318 | GM16002-PA | 1..64 | 14..77 | 312 | 96.9 | Plus |
Dsec\GM15553-PA | 107 | GM15553-PA | 10..75 | 3..66 | 162 | 69.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11755-PA | 223 | GD11755-PA | 8..84 | 1..77 | 392 | 97.4 | Plus |
Dsim\GD25056-PA | 107 | GD25056-PA | 10..75 | 3..66 | 162 | 71.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21260-PA | 66 | GJ21260-PA | 1..65 | 14..78 | 154 | 75.4 | Plus |
Dvir\GJ19999-PA | 107 | GJ19999-PA | 10..75 | 3..66 | 128 | 72.7 | Plus |