Clone RH48605 Report

Search the DGRC for RH48605

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:486
Well:5
Vector:pFlc-1
Associated Gene/TranscriptCG34423-RA
Protein status:RH48605.pep: gold
Sequenced Size:360

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34423 2009-06-08 Manual selection by Joe Carlson
CG34423 2011-03-01 Transcript Validation

Clone Sequence Records

RH48605.complete Sequence

360 bp assembled on 2009-08-11

GenBank Submission: BT099553.1

> RH48605.complete
GAGTCAGCGCTGGTATCCCAAGCAGATTCAGCACTTGAAGATGTCGCAGA
TCGGAGAACTGGGCAGTGGAGCCGGCAACGGCGGCGGCGGCGGCGGATCC
ATCCGGGAGGCGGGCGGTTCATTTGGCAAAATGGAGGCTGCTCGCGAGGA
GGAGTTCTTCTACAAGCAGCAAAAGGAGCAACTGAAGAACCTGAAGACCA
AGACGGAGCCTAAGGCACCAGAGGCTCCCAAGAAGTGAGCCCAACCAGGA
GCTTTGAACTCCACTAGCTTAACTATGGTTAGGCTGGATTGTCTGAATTG
TATTTAATGGGAATGGTACTCCAAATATATTTTGTTTAATTTACAAAAAA
AAAAAAAAAA

RH48605.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-RB 623 CG34423-RB 22..366 2..346 1725 100 Plus
CG34423-RA 387 CG34423-RA 76..387 31..342 1560 100 Plus
CG9875-RB 613 CG9875-RB 549..613 30..94 325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19245342..19245520 166..344 895 100 Plus
chr2R 21145070 chr2R 19245147..19245285 31..169 695 100 Plus
chr2R 21145070 chr2R 19268936..19269040 166..62 270 83.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23359028..23359208 166..346 905 100 Plus
2R 25286936 2R 23358833..23358971 31..169 695 100 Plus
2R 25286936 2R 23382618..23382722 166..62 270 83.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23360227..23360407 166..346 905 100 Plus
2R 25260384 2R 23360032..23360170 31..169 695 100 Plus
2R 25260384 2R 23383817..23383921 166..62 270 83.8 Minus
2R 25260384 2R 23359938..23359967 2..31 150 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:12:55 has no hits.

RH48605.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:13:43 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19245052..19245081 1..30 96 -> Plus
chr2R 19245147..19245285 31..169 74 -> Plus
chr2R 19245346..19245520 170..344 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:43 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RA 1..198 41..238 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:36 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 21..258 1..238 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:11 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 21..258 1..238 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:33:56 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 21..258 1..238 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 16:00:09 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RA 76..389 31..344 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:36 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 21..364 1..344 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:11 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 127..468 1..342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:33:56 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
CG34423-RB 127..468 1..342 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:43 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23358833..23358971 31..169 100 -> Plus
2R 23359032..23359206 170..344 100   Plus
2R 23358738..23358767 1..30 96 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:43 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23358833..23358971 31..169 100 -> Plus
2R 23359032..23359206 170..344 100   Plus
2R 23358738..23358767 1..30 96 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:43 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23358833..23358971 31..169 100 -> Plus
2R 23359032..23359206 170..344 100   Plus
2R 23358738..23358767 1..30 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:11 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19246261..19246290 1..30 96 -> Plus
arm_2R 19246356..19246494 31..169 100 -> Plus
arm_2R 19246555..19246729 170..344 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:11 Download gff for RH48605.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23359955..23359984 1..30 96 -> Plus
2R 23360050..23360188 31..169 100 -> Plus
2R 23360249..23360423 170..344 100   Plus

RH48605.hyp Sequence

Translation from 0 to 237

> RH48605.hyp
SQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREE
EFFYKQQKEQLKNLKTKTEPKAPEAPKK*

RH48605.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-PB 85 CG34423-PB 8..85 1..78 411 100 Plus
CG34423-PA 65 CG34423-PA 1..65 14..78 336 100 Plus
CG13551-PB 107 CG13551-PB 8..74 1..65 240 70.1 Plus
CG13551-PA 107 CG13551-PA 8..74 1..65 240 70.1 Plus

RH48605.pep Sequence

Translation from 1 to 237

> RH48605.pep
SQRWYPKQIQHLKMSQIGELGSGAGNGGGGGGSIREAGGSFGKMEAAREE
EFFYKQQKEQLKNLKTKTEPKAPEAPKK*

RH48605.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13139-PA 82 GF13139-PA 1..64 14..77 226 89.1 Plus
Dana\GF13051-PA 106 GF13051-PA 7..74 1..66 165 70.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22845-PA 81 GG22845-PA 1..65 14..78 239 95.4 Plus
Dere\GG20040-PA 107 GG20040-PA 10..75 3..66 162 71.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20343-PA 65 GH20343-PA 1..65 14..78 198 83.1 Plus
Dgri\GH20671-PA 106 GH20671-PA 8..74 1..66 164 71.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34423-PB 85 CG34423-PB 8..85 1..78 411 100 Plus
CG34423-PA 65 CG34423-PA 1..65 14..78 336 100 Plus
CG13551-PB 107 CG13551-PB 8..74 1..65 240 70.1 Plus
CG13551-PA 107 CG13551-PA 8..74 1..65 240 70.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20012-PA 85 GI20012-PA 8..85 1..78 275 84.6 Plus
Dmoj\GI19031-PA 107 GI19031-PA 10..75 3..66 162 71.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11441-PA 227 GL11441-PA 1..65 14..78 217 89.2 Plus
Dper\GL16907-PA 106 GL16907-PA 10..74 3..66 160 73.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12357-PA 106 GA12357-PA 10..74 3..66 160 73.8 Plus
Dpse\GA12357-PB 86 GA12357-PB 3..54 15..66 145 80.8 Plus
Dpse\GA10745-PA 244 GA10745-PA 1..74 14..78 145 63.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16002-PA 318 GM16002-PA 1..64 14..77 312 96.9 Plus
Dsec\GM15553-PA 107 GM15553-PA 10..75 3..66 162 69.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11755-PA 223 GD11755-PA 8..84 1..77 392 97.4 Plus
Dsim\GD25056-PA 107 GD25056-PA 10..75 3..66 162 71.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21260-PA 66 GJ21260-PA 1..65 14..78 154 75.4 Plus
Dvir\GJ19999-PA 107 GJ19999-PA 10..75 3..66 128 72.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22917-PA 85 GK22917-PA 8..85 1..78 261 84.6 Plus
Dwil\GK22919-PA 107 GK22919-PA 10..75 3..66 166 74.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14281-PA 82 GE14281-PA 1..65 14..78 305 96.9 Plus
Dyak\GE11575-PA 107 GE11575-PA 10..75 3..66 162 71.2 Plus