Clone RH48616 Report

Search the DGRC for RH48616

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:486
Well:16
Vector:pFlc-1
Associated Gene/TranscriptCG14823-RA
Protein status:RH48616.pep: gold
Preliminary Size:792
Sequenced Size:874

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14823 2002-10-17 Blastp of sequenced clone
CG14823 2003-01-01 Sim4 clustering to Release 3
CG14823 2008-04-29 Release 5.5 accounting
CG14823 2008-08-15 Release 5.9 accounting
CG14823 2008-12-18 5.12 accounting

Clone Sequence Records

RH48616.complete Sequence

874 bp (874 high quality bases) assembled on 2002-10-17

GenBank Submission: BT001833

> RH48616.complete
GCACAGAGTGTTCCAGCTATTCGCTTGGGTTAGTCGGTTTGCGATAGCAA
AGGGAGAAGCCAGCTCGCCATGGAGCCCACATGCAGCAGCAGTGTGGCGG
AATTGGCCAAATACAGTGAGGATGATGTGGAAACGGATGAGTCCAAGGTG
GTGGAGCATCAGGAATATGCCGAAGCGCTGTCAATGTCCGGGGAAAGTCG
TAAGCGGAAACGATGGACTCGAAGGTCCTGCTGCACTCGCCAAGTCCTGA
GTACGGGCGCCATTTTCATCGCCCTTCTGCTCATCATCGGCGCCATTTAC
ATGCACTTAAGACAGAAGCATCATCTGGGCCGACTGCACATCAATCTCAA
GGATCGGGGGCAAGTGGAGGTCCTGGAGGAGGACTTTCCCATGGTCACCG
CTGCGGGAGTGGATGCCCAGACCTCGACGATAACAACATTCCAGCCGCCT
CCGACATCCTCCCCAGAGCCCAGTGCCAAGTGCCTGGACTGCATGGCCAC
CACTGCCACGGATAATATTCCGGCAATCTGCAGGCACCGAGGACGACCAG
AGGAGCCGTGCGGCATTTATCGCATCTCCCACGTCTACTGGCAGGACGCA
CTCCGGATAATTGACCCGGACGACTCACTCGCCCGGGACTACGGAAGATG
CGTGGTGGATGTCCAGTGCGCCGAGCGTATTGTGCGTAGCTATGTGCAGC
GATATGGTGGCGAGGATTGCAATGGAGACGGACGGATCGAGTGTCGGGAT
CATGTGAGGCTGCACATGAGAGGACCCGGCGGCTGCCGCAGGCAGGAGCC
ACTGGGGAGCCTGTCTGAGAGGAGATTGGAAAACTGCTTGAAATACAGGG
GGATTACTTAAAAAAAAAAAAAAA

RH48616.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-RA 1127 CG14823-RA 238..1099 2..863 4310 100 Plus
CG14823-RB 1103 CG14823-RB 650..1100 413..863 2255 100 Plus
CG14823-RD 1133 CG14823-RD 655..1105 413..863 2255 100 Plus
CG14823-RB 1103 CG14823-RB 132..542 2..412 2055 100 Plus
CG14823-RD 1133 CG14823-RD 3..413 2..412 2055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7058536..7058946 2..412 1995 99 Plus
chr3L 24539361 chr3L 7059774..7059999 412..637 1115 99.6 Plus
chr3L 24539361 chr3L 7060223..7060445 637..859 1085 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7066316..7066726 2..412 2055 100 Plus
3L 28110227 3L 7068003..7068229 637..863 1135 100 Plus
3L 28110227 3L 7067554..7067779 412..637 1130 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7059416..7059826 2..412 2055 100 Plus
3L 28103327 3L 7061103..7061329 637..863 1135 100 Plus
3L 28103327 3L 7060654..7060879 412..637 1130 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:35:19 has no hits.

RH48616.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:36:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7058534..7058946 1..412 98 -> Plus
chr3L 7059775..7059999 413..637 99 -> Plus
chr3L 7060224..7060445 638..859 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:28 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..790 70..859 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:35 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..790 70..859 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:23 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..792 70..861 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:57 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..790 70..859 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..792 70..861 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:32 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..860 1..859 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:35 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..860 1..859 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:23 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..860 1..859 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:38 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..860 1..859 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RA 1..860 1..859 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7067555..7067779 413..637 100 -> Plus
3L 7068004..7068225 638..859 100   Plus
3L 7066314..7066726 1..412 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7067555..7067779 413..637 100 -> Plus
3L 7068004..7068225 638..859 100   Plus
3L 7066314..7066726 1..412 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:04 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7067555..7067779 413..637 100 -> Plus
3L 7068004..7068225 638..859 100   Plus
3L 7066314..7066726 1..412 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:23 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7061104..7061325 638..859 100   Plus
arm_3L 7059414..7059826 1..412 99 -> Plus
arm_3L 7060655..7060879 413..637 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:09:17 Download gff for RH48616.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7060655..7060879 413..637 100 -> Plus
3L 7061104..7061325 638..859 100   Plus
3L 7059414..7059826 1..412 99 -> Plus

RH48616.pep Sequence

Translation from 69 to 860

> RH48616.pep
MEPTCSSSVAELAKYSEDDVETDESKVVEHQEYAEALSMSGESRKRKRWT
RRSCCTRQVLSTGAIFIALLLIIGAIYMHLRQKHHLGRLHINLKDRGQVE
VLEEDFPMVTAAGVDAQTSTITTFQPPPTSSPEPSAKCLDCMATTATDNI
PAICRHRGRPEEPCGIYRISHVYWQDALRIIDPDDSLARDYGRCVVDVQC
AERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSE
RRLENCLKYRGIT*

RH48616.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25005-PA 264 GF25005-PA 7..264 6..263 604 52.6 Plus
Dana\GF11418-PA 161 GF11418-PA 35..141 138..244 174 35.4 Plus
Dana\GF11417-PA 161 GF11417-PA 57..150 164..258 172 35.1 Plus
Dana\GF11420-PA 166 GF11420-PA 32..149 138..260 168 34.9 Plus
Dana\GF11419-PA 158 GF11419-PA 30..134 138..245 147 32.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14400-PA 264 GG14400-PA 1..264 1..263 1141 86.4 Plus
Dere\GG20639-PA 161 GG20639-PA 35..141 138..244 166 35.4 Plus
Dere\GG20638-PA 161 GG20638-PA 57..150 164..258 164 34 Plus
Dere\GG20642-PA 163 GG20642-PA 29..146 138..260 162 35.7 Plus
Dere\GG20641-PA 159 GG20641-PA 31..151 137..258 160 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15386-PA 226 GH15386-PA 37..225 54..262 345 41.1 Plus
Dgri\GH22645-PA 163 GH22645-PA 35..141 138..244 172 35.7 Plus
Dgri\GH22647-PA 157 GH22647-PA 24..142 135..258 170 35.4 Plus
Dgri\GH22644-PA 161 GH22644-PA 57..149 164..257 164 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-PA 263 CG14823-PA 1..263 1..263 1405 100 Plus
CG14823-PB 116 CG14823-PB 1..114 1..114 582 100 Plus
CG14823-PD 129 CG14823-PD 1..114 1..114 582 100 Plus
CG6435-PA 163 CG6435-PA 29..144 138..258 170 37.1 Plus
CG6429-PA 159 CG6429-PA 31..151 137..258 166 33.1 Plus
CG6426-PA 161 CG6426-PA 57..149 164..257 162 34.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:45:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12991-PA 230 GI12991-PA 40..227 53..260 372 42.1 Plus
Dmoj\GI21159-PA 145 GI21159-PA 19..118 138..244 176 34.3 Plus
Dmoj\GI21157-PA 190 GI21157-PA 55..162 137..244 167 33.3 Plus
Dmoj\GI21158-PA 158 GI21158-PA 33..148 138..258 153 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25021-PA 254 GL25021-PA 1..253 1..262 595 50.4 Plus
Dper\GL11565-PA 161 GL11565-PA 35..154 138..255 162 33.9 Plus
Dper\GL11564-PA 161 GL11564-PA 57..150 164..258 154 33 Plus
Dper\GL11567-PA 132 GL11567-PA 15..108 164..258 149 34 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13274-PA 254 GA13274-PA 1..253 1..262 618 52.3 Plus
Dpse\GA19586-PA 156 GA19586-PA 21..143 131..257 168 32.8 Plus
Dpse\GA19580-PA 161 GA19580-PA 35..154 138..255 162 33.9 Plus
Dpse\GA19584-PA 161 GA19584-PA 57..150 164..258 154 33 Plus
Dpse\GA19591-PA 132 GA19591-PA 5..110 149..260 150 32.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14814-PA 263 GM14814-PA 1..263 1..263 1270 95.4 Plus
Dsec\GM21736-PA 163 GM21736-PA 29..146 138..260 175 36.5 Plus
Dsec\GM21731-PA 161 GM21731-PA 57..150 164..258 163 34 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13989-PA 263 GD13989-PA 1..263 1..263 1355 96.6 Plus
Dsim\GD11230-PA 163 GD11230-PA 29..146 138..260 175 36.5 Plus
Dsim\GD11227-PA 161 GD11227-PA 35..141 138..244 162 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13134-PA 225 GJ13134-PA 30..222 49..260 417 44.9 Plus
Dvir\GJ21010-PA 161 GJ21010-PA 35..153 138..258 182 36 Plus
Dvir\GJ21007-PA 145 GJ21007-PA 42..135 164..258 163 34 Plus
Dvir\GJ21009-PA 161 GJ21009-PA 57..150 164..258 161 33 Plus
Dvir\GJ21008-PA 161 GJ21008-PA 56..150 163..258 152 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16648-PA 274 GK16648-PA 33..272 20..256 494 46.2 Plus
Dwil\GK22025-PA 161 GK22025-PA 35..149 138..257 172 32 Plus
Dwil\GK22026-PA 166 GK22026-PA 36..155 138..255 164 34.7 Plus
Dwil\GK22028-PA 172 GK22028-PA 41..158 138..260 157 32.8 Plus
Dwil\GK22027-PA 163 GK22027-PA 27..151 124..258 146 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21589-PA 262 GE21589-PA 1..262 1..263 1116 89.4 Plus
Dyak\GE11830-PA 164 GE11830-PA 29..146 138..260 174 36.5 Plus
Dyak\GE11827-PA 161 GE11827-PA 57..150 164..258 163 34 Plus
Dyak\GE11828-PA 159 GE11828-PA 33..151 138..258 161 32.5 Plus
Dyak\GE11829-PA 159 GE11829-PA 31..151 137..258 159 33.1 Plus

RH48616.hyp Sequence

Translation from 69 to 858

> RH48616.hyp
MEPTCSSSVAELAKYSEDDVETDESKVVEHQEYAEALSMSGESRKRKRWT
RRSCCTRQVLSTGAIFIALLLIIGAIYMHLRQKHHLGRLHINLKDRGQVE
VLEEDFPMVTAAGVDAQTSTITTFQPPPTSSPEPSAKCLDCMATTATDNI
PAICRHRGRPEEPCGIYRISHVYWQDALRIIDPDDSLARDYGRCVVDVQC
AERIVRSYVQRYGGEDCNGDGRIECRDHVRLHMRGPGGCRRQEPLGSLSE
RRLENCLKYRGIT

RH48616.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-PA 263 CG14823-PA 1..263 1..263 1405 100 Plus
CG14823-PB 116 CG14823-PB 1..114 1..114 582 100 Plus
CG14823-PD 129 CG14823-PD 1..114 1..114 582 100 Plus
CG6435-PA 163 CG6435-PA 29..144 138..258 170 37.1 Plus
CG6429-PA 159 CG6429-PA 31..151 137..258 166 33.1 Plus