Clone RH49003 Report

Search the DGRC for RH49003

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:490
Well:3
Vector:pFlc-1
Associated Gene/Transcriptfabp-RB
Protein status:RH49003.pep: gold
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31305 2002-10-28 Blastp of sequenced clone
CG6783 2008-04-29 Release 5.5 accounting
CG6783 2008-08-15 Release 5.9 accounting
CG6782 2008-08-15 Release 5.9 accounting
CG6783 2008-12-18 5.12 accounting
CG6782 2008-12-18 5.12 accounting

Clone Sequence Records

RH49003.complete Sequence

710 bp (710 high quality bases) assembled on 2002-10-28

GenBank Submission: BT001835

> RH49003.complete
CATTCGCTCAGAAAATTTCAACAGTGAACATCTTGTGCAGAACACAGACC
AAATATTCCAAAAATGTCTTTCGTTGGCAAGAAGTACAAGCTGGACAAGT
CCGAGAACTTCGATGAGTACATGAAGGAGCTGGGCGTCGGTCTGGTGACG
CGCAAGATGGGCAACAGCCTGAGCCCCACAGTGGAGGTGACCTTGGAGGG
CGATACCTACACCCTGACTACCACCTCCACCTTCAAGACCTCTGCCATCA
GCTTCAAGCTGGGCGTTGAGTTCGACGAGGAGACCCTGGACGGTCGCAAC
GTCAAGAGCATCATCACCCTGGATGGCAACAAGCTGACGCAGGAGCAGAA
GGGCGACAAGCCCACCACCATCGTCCGCGAGTTCACCGACAACGAGCTGA
TCACCACCCTCACCATCGGCAACGTTAAGTGCGTGCGCGTCTACAAGGCC
GTCTAAGAGACTGATCTAAAACTATAATATCCATACGACTACATGCATTA
AAACTAACTCAGGTAGCCAATATTCTTGTTGACTAACAGTGAACTAAACC
AAATCAAATGGAACTGCACGCTCTGCCCAATGTTAATTTATAATCGCACC
CGTACACCCGCAGTCGGTGTATGTGGGAATACTCCTCGTACTCGGGGACC
AATTTCCGAATGCATTTGAATAAACTATTACTTGAAGTGCTTTTAAAAAA
AAAAAAAAAA

RH49003.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-RB 714 CG6783-RB 1..697 2..698 3470 99.8 Plus
CG6783-RA 1042 CG6783-RA 460..1025 133..698 2815 99.8 Plus
CG6783-RC 1661 CG6783-RC 1..404 2..405 2020 100 Plus
CG6783-RA 1042 CG6783-RA 1..132 2..133 660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7389572..7389860 694..406 1430 99.7 Minus
chr3R 27901430 chr3R 7389929..7390201 405..133 1365 100 Minus
chr3R 27901430 chr3R 7392406..7392539 134..1 670 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564079..11564371 698..406 1450 99.7 Minus
3R 32079331 3R 11564440..11564712 405..133 1365 100 Minus
3R 32079331 3R 11566917..11567050 134..1 670 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:11:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11304910..11305202 698..406 1450 99.6 Minus
3R 31820162 3R 11305271..11305543 405..133 1365 100 Minus
3R 31820162 3R 11307748..11307881 134..1 670 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:40:34 has no hits.

RH49003.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:41:28 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7389572..7389860 406..694 99 <- Minus
chr3R 7389929..7390200 134..405 100 <- Minus
chr3R 7392407..7392539 1..133 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:33 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..393 64..456 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:08:54 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..393 64..456 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:15:58 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RB 1..393 64..456 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:59:50 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..393 64..456 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:20 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RB 1..393 64..456 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:29:33 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..693 2..694 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:08:53 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..693 2..694 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:15:58 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RB 1..693 2..694 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:59:50 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RB 1..693 2..694 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:20 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RB 5..698 1..694 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:28 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564083..11564371 406..694 99 <- Minus
3R 11564440..11564711 134..405 100 <- Minus
3R 11566918..11567050 1..133 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:28 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564083..11564371 406..694 99 <- Minus
3R 11564440..11564711 134..405 100 <- Minus
3R 11566918..11567050 1..133 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:28 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564083..11564371 406..694 99 <- Minus
3R 11564440..11564711 134..405 100 <- Minus
3R 11566918..11567050 1..133 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:15:58 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7389805..7390093 406..694 99 <- Minus
arm_3R 7390162..7390433 134..405 100 <- Minus
arm_3R 7392640..7392772 1..133 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:31:17 Download gff for RH49003.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11304914..11305202 406..694 99 <- Minus
3R 11305271..11305542 134..405 100 <- Minus
3R 11307749..11307881 1..133 100   Minus

RH49003.hyp Sequence

Translation from 63 to 455

> RH49003.hyp
MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYT
LTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKP
TTIVREFTDNELITTLTIGNVKCVRVYKAV*

RH49003.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PB 130 CG6783-PB 1..130 1..130 656 100 Plus
fabp-PC 157 CG6783-PC 1..116 1..116 576 98.3 Plus
fabp-PA 117 CG6783-PA 11..117 24..130 536 100 Plus

RH49003.pep Sequence

Translation from 63 to 455

> RH49003.pep
MSFVGKKYKLDKSENFDEYMKELGVGLVTRKMGNSLSPTVEVTLEGDTYT
LTTTSTFKTSAISFKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKP
TTIVREFTDNELITTLTIGNVKCVRVYKAV*

RH49003.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16638-PA 130 GF16638-PA 1..130 1..130 493 86.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17215-PA 130 GG17215-PA 1..130 1..130 647 97.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15313-PA 131 GH15313-PA 3..131 2..130 526 89.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PB 130 CG6783-PB 1..130 1..130 656 100 Plus
fabp-PC 157 CG6783-PC 1..116 1..116 576 98.3 Plus
fabp-PA 117 CG6783-PA 11..117 24..130 536 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22452-PA 131 GI22452-PA 3..131 2..130 532 88.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12263-PA 131 GL12263-PA 3..131 2..130 491 90.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26243-PA 99 GA26243-PA 1..99 32..130 345 89.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26093-PA 130 GM26093-PA 1..130 1..130 648 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20655-PA 117 GD20655-PA 6..117 19..130 527 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10051-PA 131 GJ10051-PA 3..131 2..130 536 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11787-PA 131 GK11787-PA 3..131 2..130 529 90.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10108-PA 130 GE10108-PA 1..130 1..130 645 97.7 Plus