Clone RH49123 Report

Search the DGRC for RH49123

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:491
Well:23
Vector:pFlc-1
Associated Gene/TranscriptGV1-RB
Protein status:RH49123.pep: gold
Preliminary Size:1236
Sequenced Size:816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12023 2002-01-01 Sim4 clustering to Release 2
CG12023 2002-01-03 Blastp of sequenced clone
CG12023 2003-01-01 Sim4 clustering to Release 3
GV1 2008-04-29 Release 5.5 accounting
GV1 2008-08-15 Release 5.9 accounting
GV1 2008-12-18 5.12 accounting

Clone Sequence Records

RH49123.complete Sequence

816 bp (816 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075547

> RH49123.complete
GAGTGTGGCCCGTGTCTTCAATGAGTTTTGTCATGCTTTAGCGCAGAAAC
AGCGGTTCGATATCGTGATACCCACAGCATATAAACAGTATAATATACTA
TATCCTTCAGATACCAGATAGCAGCGGCAAACTAAGCGACTTAGAAGTTT
CGAGTTTCATTTGACCAAACACAATCGACACAAAATGCTCACTCCTTGCC
TGCTGCTAGTCGCCACAGTCGCCAGTTTCAGCCTCCACGCGCAGGCCATC
CGGGTGGACTGGGGCACCAACACAGGACCCATAGCACCACCTCCGCCGCG
CACCACTCCGCAGCCGCCGAGGAAACCATACCGGGATCCAGCGCCCGTCT
GGGAGGACCAGAGCGATGACGTACCCAACCCCAATCCCTATGTCTACGTG
TTGCCACCGCCTTCGAGACCAAGGACCTGGGCGATTCCCGCCGGACCATA
TGCTCCGCCCAACTACAACAACCTGCCGCCCAAGGGCAACAACTACGGCC
AGCTGGCCAGCAATTCCTACAGCGGAGGAGTGACCTCCGTGCCGGGACTG
GCCGCCCAGTATGTGCCCGGAGTGGGCATCAAGTATACGGCAATTGTGTC
TGATAAGCTGCAGGGCAAATACAATGCGAAGACCAAGAAGTACAAGGCCT
ATGAGAAGGCCAAGTACGCTTACCCCTGGAACTATGTAAGGCAATACGAG
AATCGAAAGCGATATCTGCGCTATTGAACCGCCGATACCCGATATGCATT
TAGAACTACCTATATATAATTGTACAAGAGATTAAAGCCAGACACCTCAG
AAAAAAAAAAAAAAAA

RH49123.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
GV1-RB 1002 GV1-RB 116..915 2..801 4000 100 Plus
GV1.d 1608 GV1.d 116..915 2..801 4000 100 Plus
GV1-RA 1361 GV1-RA 157..840 2..685 3420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1821315..1821721 394..800 1990 99.3 Plus
chr3L 24539361 chr3L 1820750..1820963 187..400 1025 98.6 Plus
chr3L 24539361 chr3L 1810130..1810259 2..131 650 100 Plus
chr3L 24539361 chr3L 1812177..1812232 132..187 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1821807..1822214 394..801 2040 100 Plus
3L 28110227 3L 1821213..1821426 187..400 1040 99.1 Plus
3L 28110227 3L 1810590..1810719 2..131 650 100 Plus
3L 28110227 3L 1812629..1812684 132..187 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1821807..1822214 394..801 2040 100 Plus
3L 28103327 3L 1821213..1821426 187..400 1040 99 Plus
3L 28103327 3L 1810590..1810719 2..131 650 100 Plus
3L 28103327 3L 1812629..1812684 132..187 280 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:54:54 has no hits.

RH49123.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:47 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1810129..1810259 1..131 99 -> Plus
chr3L 1812177..1812232 132..187 100 -> Plus
chr3L 1820751..1820956 188..393 99 -> Plus
chr3L 1821315..1821721 394..800 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:46:52 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 1..543 185..727 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:55:18 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 1..543 185..727 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:16 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 1..543 185..727 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:20:15 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 1..543 185..727 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:38:39 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 1..543 185..727 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:46:51 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 2..800 2..800 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:55:18 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 2..800 2..800 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:16 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 2..801 1..800 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:20:15 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 2..800 2..800 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:38:39 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
GV1-RB 2..801 1..800 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:47 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1821807..1822213 394..800 100   Plus
3L 1810589..1810719 1..131 99 -> Plus
3L 1812629..1812684 132..187 100 -> Plus
3L 1821214..1821419 188..393 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:47 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1821807..1822213 394..800 100   Plus
3L 1810589..1810719 1..131 99 -> Plus
3L 1812629..1812684 132..187 100 -> Plus
3L 1821214..1821419 188..393 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:47 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1821807..1822213 394..800 100   Plus
3L 1810589..1810719 1..131 99 -> Plus
3L 1812629..1812684 132..187 100 -> Plus
3L 1821214..1821419 188..393 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:16 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1821214..1821419 188..393 100 -> Plus
arm_3L 1821807..1822213 394..800 100   Plus
arm_3L 1810589..1810719 1..131 99 -> Plus
arm_3L 1812629..1812684 132..187 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:54:44 Download gff for RH49123.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1821807..1822213 394..800 100   Plus
3L 1810589..1810719 1..131 99 -> Plus
3L 1812629..1812684 132..187 100 -> Plus
3L 1821214..1821419 188..393 100 -> Plus

RH49123.pep Sequence

Translation from 184 to 726

> RH49123.pep
MLTPCLLLVATVASFSLHAQAIRVDWGTNTGPIAPPPPRTTPQPPRKPYR
DPAPVWEDQSDDVPNPNPYVYVLPPPSRPRTWAIPAGPYAPPNYNNLPPK
GNNYGQLASNSYSGGVTSVPGLAAQYVPGVGIKYTAIVSDKLQGKYNAKT
KKYKAYEKAKYAYPWNYVRQYENRKRYLRY*

RH49123.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24841-PA 180 GF24841-PA 3..180 2..180 578 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14830-PA 317 GG14830-PA 20..199 1..180 865 91.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16438-PA 285 GH16438-PA 1..173 1..167 546 75.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
GV1-PB 180 CG12023-PB 1..180 1..180 998 100 Plus
GV1-PA 293 CG12023-PA 1..180 1..180 937 93.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12522-PA 305 GI12522-PA 15..196 5..180 481 65.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25311-PA 183 GL25311-PA 1..183 1..180 731 88 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11345-PA 314 GA11345-PA 1..183 1..180 704 82.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14452-PA 295 GM14452-PA 1..180 1..180 725 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13652-PA 295 GD13652-PA 1..180 1..180 694 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12426-PA 205 GJ12426-PA 31..205 5..180 543 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20331-PA 210 GK20331-PA 24..210 1..180 548 70.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21193-PA 297 GE21193-PA 1..180 1..180 716 91.7 Plus

RH49123.hyp Sequence

Translation from 184 to 726

> RH49123.hyp
MLTPCLLLVATVASFSLHAQAIRVDWGTNTGPIAPPPPRTTPQPPRKPYR
DPAPVWEDQSDDVPNPNPYVYVLPPPSRPRTWAIPAGPYAPPNYNNLPPK
GNNYGQLASNSYSGGVTSVPGLAAQYVPGVGIKYTAIVSDKLQGKYNAKT
KKYKAYEKAKYAYPWNYVRQYENRKRYLRY*

RH49123.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
GV1-PB 180 CG12023-PB 1..180 1..180 998 100 Plus
GV1-PA 293 CG12023-PA 1..180 1..180 937 93.9 Plus