BDGP Sequence Production Resources |
Search the DGRC for RH49123
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 491 |
Well: | 23 |
Vector: | pFlc-1 |
Associated Gene/Transcript | GV1-RB |
Protein status: | RH49123.pep: gold |
Preliminary Size: | 1236 |
Sequenced Size: | 816 |
Gene | Date | Evidence |
---|---|---|
CG12023 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12023 | 2002-01-03 | Blastp of sequenced clone |
CG12023 | 2003-01-01 | Sim4 clustering to Release 3 |
GV1 | 2008-04-29 | Release 5.5 accounting |
GV1 | 2008-08-15 | Release 5.9 accounting |
GV1 | 2008-12-18 | 5.12 accounting |
816 bp (816 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075547
> RH49123.complete GAGTGTGGCCCGTGTCTTCAATGAGTTTTGTCATGCTTTAGCGCAGAAAC AGCGGTTCGATATCGTGATACCCACAGCATATAAACAGTATAATATACTA TATCCTTCAGATACCAGATAGCAGCGGCAAACTAAGCGACTTAGAAGTTT CGAGTTTCATTTGACCAAACACAATCGACACAAAATGCTCACTCCTTGCC TGCTGCTAGTCGCCACAGTCGCCAGTTTCAGCCTCCACGCGCAGGCCATC CGGGTGGACTGGGGCACCAACACAGGACCCATAGCACCACCTCCGCCGCG CACCACTCCGCAGCCGCCGAGGAAACCATACCGGGATCCAGCGCCCGTCT GGGAGGACCAGAGCGATGACGTACCCAACCCCAATCCCTATGTCTACGTG TTGCCACCGCCTTCGAGACCAAGGACCTGGGCGATTCCCGCCGGACCATA TGCTCCGCCCAACTACAACAACCTGCCGCCCAAGGGCAACAACTACGGCC AGCTGGCCAGCAATTCCTACAGCGGAGGAGTGACCTCCGTGCCGGGACTG GCCGCCCAGTATGTGCCCGGAGTGGGCATCAAGTATACGGCAATTGTGTC TGATAAGCTGCAGGGCAAATACAATGCGAAGACCAAGAAGTACAAGGCCT ATGAGAAGGCCAAGTACGCTTACCCCTGGAACTATGTAAGGCAATACGAG AATCGAAAGCGATATCTGCGCTATTGAACCGCCGATACCCGATATGCATT TAGAACTACCTATATATAATTGTACAAGAGATTAAAGCCAGACACCTCAG AAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1821315..1821721 | 394..800 | 1990 | 99.3 | Plus |
chr3L | 24539361 | chr3L | 1820750..1820963 | 187..400 | 1025 | 98.6 | Plus |
chr3L | 24539361 | chr3L | 1810130..1810259 | 2..131 | 650 | 100 | Plus |
chr3L | 24539361 | chr3L | 1812177..1812232 | 132..187 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1821807..1822214 | 394..801 | 2040 | 100 | Plus |
3L | 28110227 | 3L | 1821213..1821426 | 187..400 | 1040 | 99.1 | Plus |
3L | 28110227 | 3L | 1810590..1810719 | 2..131 | 650 | 100 | Plus |
3L | 28110227 | 3L | 1812629..1812684 | 132..187 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1821807..1822214 | 394..801 | 2040 | 100 | Plus |
3L | 28103327 | 3L | 1821213..1821426 | 187..400 | 1040 | 99 | Plus |
3L | 28103327 | 3L | 1810590..1810719 | 2..131 | 650 | 100 | Plus |
3L | 28103327 | 3L | 1812629..1812684 | 132..187 | 280 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1810129..1810259 | 1..131 | 99 | -> | Plus |
chr3L | 1812177..1812232 | 132..187 | 100 | -> | Plus |
chr3L | 1820751..1820956 | 188..393 | 99 | -> | Plus |
chr3L | 1821315..1821721 | 394..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 1..543 | 185..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 1..543 | 185..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 1..543 | 185..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 1..543 | 185..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 1..543 | 185..727 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 2..800 | 2..800 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 2..800 | 2..800 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 2..801 | 1..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 2..800 | 2..800 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
GV1-RB | 2..801 | 1..800 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1821807..1822213 | 394..800 | 100 | Plus | |
3L | 1810589..1810719 | 1..131 | 99 | -> | Plus |
3L | 1812629..1812684 | 132..187 | 100 | -> | Plus |
3L | 1821214..1821419 | 188..393 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1821807..1822213 | 394..800 | 100 | Plus | |
3L | 1810589..1810719 | 1..131 | 99 | -> | Plus |
3L | 1812629..1812684 | 132..187 | 100 | -> | Plus |
3L | 1821214..1821419 | 188..393 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1821807..1822213 | 394..800 | 100 | Plus | |
3L | 1810589..1810719 | 1..131 | 99 | -> | Plus |
3L | 1812629..1812684 | 132..187 | 100 | -> | Plus |
3L | 1821214..1821419 | 188..393 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1821214..1821419 | 188..393 | 100 | -> | Plus |
arm_3L | 1821807..1822213 | 394..800 | 100 | Plus | |
arm_3L | 1810589..1810719 | 1..131 | 99 | -> | Plus |
arm_3L | 1812629..1812684 | 132..187 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1821807..1822213 | 394..800 | 100 | Plus | |
3L | 1810589..1810719 | 1..131 | 99 | -> | Plus |
3L | 1812629..1812684 | 132..187 | 100 | -> | Plus |
3L | 1821214..1821419 | 188..393 | 100 | -> | Plus |
Translation from 184 to 726
> RH49123.pep MLTPCLLLVATVASFSLHAQAIRVDWGTNTGPIAPPPPRTTPQPPRKPYR DPAPVWEDQSDDVPNPNPYVYVLPPPSRPRTWAIPAGPYAPPNYNNLPPK GNNYGQLASNSYSGGVTSVPGLAAQYVPGVGIKYTAIVSDKLQGKYNAKT KKYKAYEKAKYAYPWNYVRQYENRKRYLRY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24841-PA | 180 | GF24841-PA | 3..180 | 2..180 | 578 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14830-PA | 317 | GG14830-PA | 20..199 | 1..180 | 865 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16438-PA | 285 | GH16438-PA | 1..173 | 1..167 | 546 | 75.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
GV1-PB | 180 | CG12023-PB | 1..180 | 1..180 | 998 | 100 | Plus |
GV1-PA | 293 | CG12023-PA | 1..180 | 1..180 | 937 | 93.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12522-PA | 305 | GI12522-PA | 15..196 | 5..180 | 481 | 65.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25311-PA | 183 | GL25311-PA | 1..183 | 1..180 | 731 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11345-PA | 314 | GA11345-PA | 1..183 | 1..180 | 704 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14452-PA | 295 | GM14452-PA | 1..180 | 1..180 | 725 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13652-PA | 295 | GD13652-PA | 1..180 | 1..180 | 694 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12426-PA | 205 | GJ12426-PA | 31..205 | 5..180 | 543 | 73.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20331-PA | 210 | GK20331-PA | 24..210 | 1..180 | 548 | 70.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21193-PA | 297 | GE21193-PA | 1..180 | 1..180 | 716 | 91.7 | Plus |
Translation from 184 to 726
> RH49123.hyp MLTPCLLLVATVASFSLHAQAIRVDWGTNTGPIAPPPPRTTPQPPRKPYR DPAPVWEDQSDDVPNPNPYVYVLPPPSRPRTWAIPAGPYAPPNYNNLPPK GNNYGQLASNSYSGGVTSVPGLAAQYVPGVGIKYTAIVSDKLQGKYNAKT KKYKAYEKAKYAYPWNYVRQYENRKRYLRY*