Clone RH49324 Report

Search the DGRC for RH49324

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:493
Well:24
Vector:pFlc-1
Associated Gene/TranscriptCoVb-RA
Protein status:RH49324.pep: gold
Preliminary Size:590
Sequenced Size:585

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11015 2002-01-01 Sim4 clustering to Release 2
CG11015 2003-02-13 Blastp of sequenced clone
CG11015 2008-04-29 Release 5.5 accounting
CG11015 2008-08-15 Release 5.9 accounting
CG11015 2008-12-18 5.12 accounting

Clone Sequence Records

RH49324.complete Sequence

585 bp (585 high quality bases) assembled on 2003-02-13

GenBank Submission: BT004475

> RH49324.complete
GACTTTACCGCGGTCACACTGATCCATAGCTGTGTGAAAAATTACGAAAG
AATTTTTGGTGTTCACCACTTAAGACCGACCGAAATTTTCGCAAAACGAA
CAATGGCATCGATCTGTGGACGCATGGCGCTCCGTGCCGCCGCACGCCAG
AATGTTGCCTACACGCCCGTGCGCTTCTGCAAAATGATGAACGATCCTTT
GGAGCACGCCACTGGTATCGAGAAGCGCGAGCTGCTGCTTAAGGCCGCCG
GCAATGATAACCCCTTCGACATGAAGGTCTTCAAGCGGGGCGCCGGCACC
AAGGAGAACCCCAACCTTATTCCATCGGCCTTCGATGCTCGCATTGTGGG
CTGCATCTGCGAAGAGGATCAGACCTACGTGCAATGGATGTGGCTGCAGA
AGGGCAACCAGAAACGTTGTGAGTGCGGCCATTGGTTCAAGCTGGTGGAG
AAGGCAGCTGTTTAAAGTTATTATTAATTAATTCAATAAACCAATTAATA
ACAAAAACACAACAACTACTAAGCTAAAAGTCAACCCACTTAGCTGTCCA
AATAAACAAACATCAACCCAAAAAAAAAAAAAAAA

RH49324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11015-RA 917 CG11015-RA 111..694 2..585 2920 100 Plus
CG11015.a 613 CG11015.a 70..470 185..585 2005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6557918..6558128 359..569 1055 100 Plus
chr2L 23010047 chr2L 6556781..6556963 2..184 915 100 Plus
chr2L 23010047 chr2L 6557397..6557571 185..359 815 97.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6558939..6559165 359..585 1135 100 Plus
2L 23513712 2L 6557802..6557984 2..184 915 100 Plus
2L 23513712 2L 6558418..6558592 185..359 875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6558939..6559165 359..585 1135 100 Plus
2L 23513712 2L 6557802..6557984 2..184 915 100 Plus
2L 23513712 2L 6558418..6558592 185..359 875 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:40:55 has no hits.

RH49324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:41:41 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6556780..6556963 1..184 99 -> Plus
chr2L 6557397..6557570 185..358 97 -> Plus
chr2L 6557918..6558128 359..569 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:37 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 1..363 103..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:43 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 1..363 103..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:16:12 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CoVb-RA 1..363 103..465 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:38 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 1..363 103..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:46:30 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CoVb-RA 1..363 103..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:46 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 2..570 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:43 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 2..570 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:16:12 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CoVb-RA 2..570 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:38 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CG11015-RA 2..570 1..569 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:46:30 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
CoVb-RA 2..570 1..569 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:41 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6557801..6557984 1..184 99 -> Plus
2L 6558418..6558591 185..358 100 -> Plus
2L 6558939..6559149 359..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:41 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6557801..6557984 1..184 99 -> Plus
2L 6558418..6558591 185..358 100 -> Plus
2L 6558939..6559149 359..569 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:41:41 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6557801..6557984 1..184 99 -> Plus
2L 6558418..6558591 185..358 100 -> Plus
2L 6558939..6559149 359..569 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:16:12 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6558418..6558591 185..358 100 -> Plus
arm_2L 6558939..6559149 359..569 100   Plus
arm_2L 6557801..6557984 1..184 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:08:50 Download gff for RH49324.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6558939..6559149 359..569 100   Plus
2L 6557801..6557984 1..184 99 -> Plus
2L 6558418..6558591 185..358 100 -> Plus

RH49324.hyp Sequence

Translation from 0 to 464

> RH49324.hyp
YFTAVTLIHSCVKNYERIFGVHHLRPTEIFAKRTMASICGRMALRAAARQ
NVAYTPVRFCKMMNDPLEHATGIEKRELLLKAAGNDNPFDMKVFKRGAGT
KENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRCECGHWFKLVE
KAAV*

RH49324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
CoVb-PB 120 CG11015-PB 1..120 35..154 651 100 Plus
CoVb-PA 120 CG11015-PA 1..120 35..154 651 100 Plus
CG11043-PA 154 CG11043-PA 29..148 35..148 223 41.8 Plus

RH49324.pep Sequence

Translation from 102 to 464

> RH49324.pep
MASICGRMALRAAARQNVAYTPVRFCKMMNDPLEHATGIEKRELLLKAAG
NDNPFDMKVFKRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQK
GNQKRCECGHWFKLVEKAAV*

RH49324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14170-PA 120 GF14170-PA 1..120 1..120 639 98.3 Plus
Dana\GF14171-PA 155 GF14171-PA 47..149 12..114 219 41.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10419-PA 120 GG10419-PA 1..120 1..120 643 99.2 Plus
Dere\GG10420-PA 155 GG10420-PA 44..149 9..114 220 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13841-PA 120 GH13841-PA 1..120 1..120 616 95 Plus
Dgri\GH13842-PA 157 GH13842-PA 66..157 29..120 257 53.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
COX5B-PB 120 CG11015-PB 1..120 1..120 651 100 Plus
COX5B-PA 120 CG11015-PA 1..120 1..120 651 100 Plus
COX5BL-PA 154 CG11043-PA 29..148 1..114 223 41.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20346-PA 120 GI20346-PA 1..120 1..120 625 96.7 Plus
Dmoj\GI20357-PA 160 GI20357-PA 53..160 12..120 279 53.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25676-PA 120 GL25676-PA 1..120 1..120 629 96.7 Plus
Dper\GL25677-PA 151 GL25677-PA 29..145 1..114 264 45.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28177-PA 120 GA28177-PA 1..120 1..120 629 96.7 Plus
Dpse\GA10709-PA 120 GA10709-PA 1..120 1..120 629 96.7 Plus
Dpse\GA28178-PA 151 GA28178-PA 29..145 1..114 264 45.4 Plus
Dpse\GA10724-PA 151 GA10724-PA 29..145 1..114 264 45.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16172-PA 120 GM16172-PA 1..120 1..120 647 100 Plus
Dsec\GM16174-PA 155 GM16174-PA 44..149 9..114 222 42.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23418-PA 120 GD23418-PA 1..120 1..120 647 100 Plus
Dsim\CoVb-PA 155 GD23419-PA 44..149 9..114 222 42.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13698-PA 120 GJ13698-PA 1..120 1..120 624 96.7 Plus
Dvir\GJ13709-PA 158 GJ13709-PA 51..158 12..120 272 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15323-PA 120 GK15323-PA 1..120 1..120 633 97.5 Plus
Dwil\GK15324-PA 151 GK15324-PA 50..145 18..114 309 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13966-PA 120 GE13966-PA 1..120 1..120 642 99.2 Plus
Dyak\GE13977-PA 155 GE13977-PA 44..149 9..114 227 43.5 Plus