Clone RH49423 Report

Search the DGRC for RH49423

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:494
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG5028-RA
Protein status:RH49423.pep: gold
Preliminary Size:1312
Sequenced Size:1450

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5028 2002-01-01 Sim4 clustering to Release 2
CG5028 2002-05-30 Blastp of sequenced clone
CG5028 2003-01-01 Sim4 clustering to Release 3
CG5028 2008-04-29 Release 5.5 accounting
CG5028 2008-08-15 Release 5.9 accounting
CG5028 2008-12-18 5.12 accounting

Clone Sequence Records

RH49423.complete Sequence

1450 bp (1450 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118436

> RH49423.complete
GATCGTTTACTTGACAACCCTGAAAAGCCGTGGTTCTGGGCAAGAGCCAG
CAGCACCGTTTTGGCCAAGTGGAATAAAATTGGCTGTGATTTAACTGATA
GTAGAATACCAACTGCAGCGGTAGAAAACAATAATCCAAGGATCAAATCA
TGGCCCTTCGCTTGACCCAGAGATTGCTGCAGACGCAGACGCCGTTCCTC
ACTCGCGGCTATCCCTTGCTGGTGACCAAGGAGAAGACCGAGGATGTGGC
CCACACCAAATCGGCGCTGCAGAAGAAAGTCACGGGCACCGATATTCCCT
CGGCACAGTACGGAGGTCGTCATGCCGTCACCATGCTGCCGGGCGGCGGC
ATTGGTCCTGAACTGATGGGCTATGTGCGCGAGATCTTCCGGTATTGCGG
TGCACCCATCGATTTCGAGGTGATCGACATCGATCCCTCCACCGAGGGCA
ACGATGATCTGGACTATGCCATCACATCGATTAAGAGGAACGGAGTGGCA
CTCAAGGGCAACATCGAGACCAAGTCCCAATCCTTGACCGAAGTCTCCCG
CAACGTGGCCATCCGTAACGAGCTGGATCTGTACGTCAATGTGGTGCACT
GCAAGTCGTATCCGGGCATTCCGGCCCGCCATCACGACATTGACGTGGTG
CTCATCCGCCAAAACACCGATGGCGAGTACGCCATGTTGGAACATGAGTC
TGTGCCCGGAATTGTGGAGAGCATGAAAGTGGTGACCGTCGAGAATGCCG
AGCGTGTGGCCCGCTACGCCTTTGAGTTCGCCCGCCAAAACAATCGCAAG
AAGGTTACCACCATTCACAAGGCCAACATCATGAAGCTGTCCGATGGTCT
CTTCCTGGAGGTTGCCAACCGTGTGCACAAGGACTATCCCGAACTGGAGC
ACAACAACATGATTATCGACAACACCTGCATGCAGTCCGTGTCGAATCCT
CACCAGTTCGACGTGATGAACATGACCAATCTGTACGGCACCATCGTGTC
CAATGTTCTTTGCGGTTTGATGGGCGGAGCTGGCCTCATATCCGGCAGGA
ACTACGGTGACCATTACGCCATCTTTGAGCCTGGCACCCGTAACACAGGA
ACCGCCATTGCCGGCAAGAATATCGCCAACCCTGTGGCCATGATCAGTGC
CAGTATCGATATGTTGAACCATCTGGGCCACAAGGAGCACGCCAATGTCA
TTCAGGAGGCCGTCTACCAGACCATTGTCAACGATGCCATTCGCACGCCA
GATATTGGCGGCACCAACTCCAGTACCGATGTGGTTGAGAATATACTCAA
GATCTTGAGTGCCAAGCGCGTGAATTGGCCACATGGAAACTATTTTAGCC
AAATTTAGGCACTATCGCACTACCGAATTCAACCAACTGCTAACAAATTC
AGCAAGATAAACCAAATCGAACCAAGTCTAATACAAAAAAAAAAAAAAAA

RH49423.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-RA 1566 CG5028-RA 6..1447 6..1447 7195 99.9 Plus
CG5028.d 2151 CG5028.d 82..1404 6..1328 6600 99.9 Plus
CG5028.e 2383 CG5028.e 82..1404 6..1328 6600 99.9 Plus
CG5028.d 2151 CG5028.d 2029..2149 1327..1447 605 100 Plus
CG5028.e 2383 CG5028.e 2029..2149 1327..1447 605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21504299..21505079 284..1064 3905 100 Plus
chr3R 27901430 chr3R 21503857..21504058 6..207 1010 100 Plus
chr3R 27901430 chr3R 21505139..21505325 1065..1251 920 99.5 Plus
chr3R 27901430 chr3R 21506091..21506198 1327..1434 540 100 Plus
chr3R 27901430 chr3R 21505387..21505466 1249..1328 400 100 Plus
chr3R 27901430 chr3R 21504155..21504233 207..285 395 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:31:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25681265..25682045 284..1064 3905 100 Plus
3R 32079331 3R 25680823..25681024 6..207 1010 100 Plus
3R 32079331 3R 25682105..25682291 1065..1251 920 99.5 Plus
3R 32079331 3R 25683057..25683177 1327..1447 605 100 Plus
3R 32079331 3R 25682353..25682432 1249..1328 400 100 Plus
3R 32079331 3R 25681121..25681199 207..285 395 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25422096..25422876 284..1064 3905 100 Plus
3R 31820162 3R 25421654..25421855 6..207 1010 100 Plus
3R 31820162 3R 25422936..25423122 1065..1251 920 99.4 Plus
3R 31820162 3R 25423888..25424008 1327..1447 605 100 Plus
3R 31820162 3R 25423184..25423263 1249..1328 400 100 Plus
3R 31820162 3R 25421952..25422030 207..285 395 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:08:59 has no hits.

RH49423.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:10:05 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21503852..21504057 1..206 98 -> Plus
chr3R 21504155..21504232 207..284 100 -> Plus
chr3R 21504300..21505079 285..1064 100 -> Plus
chr3R 21505139..21505325 1065..1251 99 -> Plus
chr3R 21505390..21505465 1252..1327 100 -> Plus
chr3R 21506092..21506198 1328..1434 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:41 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1209 150..1358 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:35:50 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1209 150..1358 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:06:38 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RA 1..1209 150..1358 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:27:24 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1209 150..1358 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:57:54 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RA 1..1209 150..1358 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:07:35 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1434 3..1434 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:35:50 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1434 3..1434 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:06:38 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RA 1..1407 28..1434 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:27:24 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RB 1..1434 3..1434 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:57:54 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
CG5028-RA 1..1407 28..1434 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:05 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25680818..25681023 1..206 98 -> Plus
3R 25681121..25681198 207..284 100 -> Plus
3R 25681266..25682045 285..1064 100 -> Plus
3R 25682105..25682291 1065..1251 99 -> Plus
3R 25682356..25682431 1252..1327 100 -> Plus
3R 25683058..25683164 1328..1434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:05 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25680818..25681023 1..206 98 -> Plus
3R 25681121..25681198 207..284 100 -> Plus
3R 25681266..25682045 285..1064 100 -> Plus
3R 25682105..25682291 1065..1251 99 -> Plus
3R 25682356..25682431 1252..1327 100 -> Plus
3R 25683058..25683164 1328..1434 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:05 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25680818..25681023 1..206 98 -> Plus
3R 25681121..25681198 207..284 100 -> Plus
3R 25681266..25682045 285..1064 100 -> Plus
3R 25682105..25682291 1065..1251 99 -> Plus
3R 25682356..25682431 1252..1327 100 -> Plus
3R 25683058..25683164 1328..1434 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:06:38 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21506540..21506745 1..206 98 -> Plus
arm_3R 21506843..21506920 207..284 100 -> Plus
arm_3R 21506988..21507767 285..1064 100 -> Plus
arm_3R 21507827..21508013 1065..1251 99 -> Plus
arm_3R 21508078..21508153 1252..1327 100 -> Plus
arm_3R 21508780..21508886 1328..1434 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:59:54 Download gff for RH49423.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25422097..25422876 285..1064 100 -> Plus
3R 25422936..25423122 1065..1251 99 -> Plus
3R 25423187..25423262 1252..1327 100 -> Plus
3R 25423889..25423995 1328..1434 100   Plus
3R 25421952..25422029 207..284 100 -> Plus
3R 25421649..25421854 1..206 98 -> Plus

RH49423.hyp Sequence

Translation from 149 to 1357

> RH49423.hyp
MALRLTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIP
SAQYGGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEG
NDDLDYAITSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVH
CKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVTVENA
ERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELE
HNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGR
NYGDHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANV
IQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRVNWPHGNYFS
QI*

RH49423.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PB 402 CG5028-PB 1..402 1..402 2086 100 Plus
CG5028-PA 402 CG5028-PA 1..402 1..402 2086 100 Plus
CG5028-PD 393 CG5028-PD 1..393 1..393 2033 100 Plus
CG5028-PC 392 CG5028-PC 1..392 1..392 2022 100 Plus
CG6439-PB 370 CG6439-PB 22..370 35..387 791 43.7 Plus

RH49423.pep Sequence

Translation from 149 to 1357

> RH49423.pep
MALRLTQRLLQTQTPFLTRGYPLLVTKEKTEDVAHTKSALQKKVTGTDIP
SAQYGGRHAVTMLPGGGIGPELMGYVREIFRYCGAPIDFEVIDIDPSTEG
NDDLDYAITSIKRNGVALKGNIETKSQSLTEVSRNVAIRNELDLYVNVVH
CKSYPGIPARHHDIDVVLIRQNTDGEYAMLEHESVPGIVESMKVVTVENA
ERVARYAFEFARQNNRKKVTTIHKANIMKLSDGLFLEVANRVHKDYPELE
HNNMIIDNTCMQSVSNPHQFDVMNMTNLYGTIVSNVLCGLMGGAGLISGR
NYGDHYAIFEPGTRNTGTAIAGKNIANPVAMISASIDMLNHLGHKEHANV
IQEAVYQTIVNDAIRTPDIGGTNSSTDVVENILKILSAKRVNWPHGNYFS
QI*

RH49423.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16768-PA 402 GF16768-PA 1..402 1..402 2064 94.8 Plus
Dana\GF22695-PA 255 GF22695-PA 1..255 148..402 1294 92.9 Plus
Dana\GF16953-PA 371 GF16953-PA 38..367 57..383 774 45.8 Plus
Dana\GF20487-PA 377 GF20487-PA 42..377 52..386 675 40.7 Plus
Dana\GF13612-PA 412 GF13612-PA 88..403 60..382 445 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11421-PA 402 GG11421-PA 1..402 1..402 2141 99 Plus
Dere\GG12546-PA 370 GG12546-PA 22..366 35..383 765 43.9 Plus
Dere\GG18052-PA 377 GG18052-PA 32..373 43..382 672 40.6 Plus
Dere\GG22965-PA 395 GG22965-PA 3..393 6..388 464 27.6 Plus
Dere\GG22281-PA 378 GG22281-PA 29..377 37..392 413 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18988-PA 402 GH18988-PA 1..401 1..401 1993 91 Plus
Dgri\GH19869-PA 370 GH19869-PA 35..366 55..383 771 45.5 Plus
Dgri\GH17867-PA 354 GH17867-PA 6..354 40..386 671 40.1 Plus
Dgri\GH16376-PA 361 GH16376-PA 21..349 60..387 664 41.7 Plus
Dgri\GH20895-PA 386 GH20895-PA 63..382 60..387 521 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG5028-PB 402 CG5028-PB 1..402 1..402 2086 100 Plus
CG5028-PA 402 CG5028-PA 1..402 1..402 2086 100 Plus
CG5028-PD 393 CG5028-PD 1..393 1..393 2033 100 Plus
CG5028-PC 392 CG5028-PC 1..392 1..392 2022 100 Plus
Idh3b-PB 370 CG6439-PB 22..370 35..387 791 43.7 Plus
Idh3b-PA 370 CG6439-PA 22..370 35..387 791 43.7 Plus
l(1)G0156-PC 354 CG12233-PC 6..350 40..382 677 40.8 Plus
l(1)G0156-PA 354 CG12233-PA 6..350 40..382 677 40.8 Plus
l(1)G0156-PD 377 CG12233-PD 1..373 1..382 676 38.1 Plus
CG32026-PA 719 CG32026-PA 380..718 55..386 581 36.4 Plus
CG3483-PA 391 CG3483-PA 3..391 6..386 448 28.5 Plus
CG7755-PA 378 CG7755-PA 45..374 49..389 411 31.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22415-PA 402 GI22415-PA 1..401 1..401 2028 92.8 Plus
Dmoj\GI22037-PA 370 GI22037-PA 27..366 44..383 781 46.1 Plus
Dmoj\GI16435-PA 377 GI16435-PA 1..377 1..386 697 39.7 Plus
Dmoj\GI11568-PA 354 GI11568-PA 27..350 60..382 686 42.3 Plus
Dmoj\GI18905-PA 399 GI18905-PA 78..395 60..387 488 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:20:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21529-PA 402 GL21529-PA 1..402 1..402 2036 93.3 Plus
Dper\GL23725-PA 378 GL23725-PA 22..374 35..383 794 45.1 Plus
Dper\GL14780-PA 351 GL14780-PA 38..351 52..386 566 37.5 Plus
Dper\GL11354-PA 395 GL11354-PA 33..383 22..386 453 29.7 Plus
Dper\GL20101-PA 411 GL20101-PA 86..411 57..389 447 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18606-PA 402 GA18606-PA 1..402 1..402 2036 93.3 Plus
Dpse\GA19594-PA 378 GA19594-PA 22..374 35..383 794 45.1 Plus
Dpse\GA11495-PA 373 GA11495-PA 33..373 50..386 671 40.4 Plus
Dpse\GA16620-PA 332 GA16620-PA 1..329 63..384 583 36.3 Plus
Dpse\GA24694-PA 395 GA24694-PA 33..383 22..386 453 29.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10262-PA 321 GM10262-PA 1..321 73..393 1711 99.7 Plus
Dsec\GM23677-PA 370 GM23677-PA 24..366 45..383 762 44.1 Plus
Dsec\GM22739-PA 377 GM22739-PA 1..377 1..386 683 38.4 Plus
Dsec\GM11859-PA 389 GM11859-PA 3..389 6..386 459 28.8 Plus
Dsec\GM20069-PA 378 GM20069-PA 45..374 49..389 411 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21232-PA 392 GD21232-PA 1..392 1..393 1989 95.9 Plus
Dsim\GD18486-PA 370 GD18486-PA 24..366 45..383 762 44.1 Plus
Dsim\GD15579-PA 377 GD15579-PA 1..377 1..386 685 37.9 Plus
Dsim\GD14133-PA 722 GD14133-PA 386..721 58..386 582 36.4 Plus
Dsim\GD11857-PA 388 GD11857-PA 3..388 6..386 425 28 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10975-PA 402 GJ10975-PA 1..401 1..401 2004 91 Plus
Dvir\GJ24090-PA 371 GJ24090-PA 28..367 48..383 778 45.6 Plus
Dvir\GJ11248-PA 367 GJ11248-PA 23..367 56..399 691 39.8 Plus
Dvir\GJ20729-PA 426 GJ20729-PA 73..422 28..387 496 31.9 Plus
Dvir\GJ22018-PA 392 GJ22018-PA 54..382 49..388 482 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12856-PA 402 GK12856-PA 1..402 1..402 2034 93.5 Plus
Dwil\GK13007-PA 370 GK13007-PA 31..366 52..383 763 44.7 Plus
Dwil\GK25509-PA 379 GK25509-PA 31..379 40..386 674 39.8 Plus
Dwil\GK19318-PA 388 GK19318-PA 52..386 49..402 468 32 Plus
Dwil\GK19462-PA 390 GK19462-PA 7..294 78..370 450 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:21:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23616-PA 402 GE23616-PA 1..402 1..402 2149 99.5 Plus
Dyak\GE24066-PA 370 GE24066-PA 24..366 45..383 762 44.1 Plus
Dyak\GE14404-PA 393 GE14404-PA 20..391 21..388 466 29.5 Plus
Dyak\GE14076-PA 378 GE14076-PA 45..377 49..392 422 30.3 Plus
Dyak\GE17383-PA 268 GE17383-PA 112..268 229..386 280 35.4 Plus