Clone RH49748 Report

Search the DGRC for RH49748

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:497
Well:48
Vector:pFlc-1
Associated Gene/TranscriptCG2862-RA
Protein status:RH49748.pep: gold
Preliminary Size:596
Sequenced Size:560

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2862 2001-12-17 Blastp of sequenced clone
CG2862 2002-01-01 Sim4 clustering to Release 2
CG2862 2003-01-01 Sim4 clustering to Release 3
CG2862 2008-04-29 Release 5.5 accounting
CG2862 2008-08-15 Release 5.9 accounting
CG2862 2008-12-18 5.12 accounting

Clone Sequence Records

RH49748.complete Sequence

560 bp (560 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071745

> RH49748.complete
GAGCGCTATTTCGATGTTCTTGTCAACCGGCCGGAATTTCTTTCGTGTTT
TCAGCTCTCGCCAAATAGCAAGCTGCAGTGCTAGAATGGCAAGCGAAGTG
GAAAAATCGCAAACGGCAGCCGCCAGTGAAGACACCATTTTCGGCAAGAT
TTTGCGCAAGGAGATCCCATGCAAATTTATCCACGAGGATGATAAATGCG
TTGCCTTCCACGATGTGGCGCCCCAGGCACCAACCCACTTCCTCGTGATT
CCTCGCAAGCCAATTGCCCAACTCTCGCTAGCCGAGGATGGAGATGCCGA
TCTGCTGGGACATCTCATGCTGGTGGGCCGCAAGGTGGCCAAGGAGCTCG
GCCTCGCGGATGGCTACCGCGTGGTCATCAACAATGGCAAGCACGGCGCC
CAGTCAGTTTACCACTTGCATTTGCACTTCCTCGGCGGCCGCCAGATGCA
GTGGCCACCAGGATAAGAAGCAGCCGATGGTGCAGCTACCAGATCCAAGA
TCATTTACACCACAGAGAATTTTTGAAATAAACTATGTGAAATGCAAAAA
AAAAAAAAAA

RH49748.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG2862.a 782 CG2862.a 143..691 2..550 2730 99.8 Plus
CG2862-RA 684 CG2862-RA 45..593 2..550 2730 99.8 Plus
CG2862-RB 703 CG2862-RB 114..612 52..550 2480 99.7 Plus
CG2862-RB 703 CG2862-RB 1..49 6..54 245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2770182..2770530 197..545 1745 100 Plus
chr2L 23010047 chr2L 2769977..2770121 52..196 710 99.3 Plus
chr2L 23010047 chr2L 2769860..2769912 2..54 265 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2770460..2770813 197..550 1755 99.7 Plus
2L 23513712 2L 2770256..2770400 52..196 725 100 Plus
2L 23513712 2L 2770139..2770191 2..54 265 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2770460..2770813 197..550 1755 99.7 Plus
2L 23513712 2L 2770256..2770400 52..196 725 100 Plus
2L 23513712 2L 2770139..2770191 2..54 265 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:40:03 has no hits.

RH49748.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:40:41 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2769858..2769912 1..54 98 -> Plus
chr2L 2769980..2770121 55..196 99 -> Plus
chr2L 2770182..2770530 197..545 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:45 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..453 14..466 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:20 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..453 14..466 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:05 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..453 14..466 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:05 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..453 14..466 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:36:08 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..453 14..466 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:17 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..546 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:58:20 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 2..547 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:05 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 3..548 1..545 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:05 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 1..546 1..545 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:36:08 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
CG2862-RA 3..548 1..545 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:41 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2770137..2770191 1..54 98 -> Plus
2L 2770259..2770400 55..196 100 -> Plus
2L 2770460..2770808 197..545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:41 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2770137..2770191 1..54 98 -> Plus
2L 2770259..2770400 55..196 100 -> Plus
2L 2770460..2770808 197..545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:40:41 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2770137..2770191 1..54 98 -> Plus
2L 2770259..2770400 55..196 100 -> Plus
2L 2770460..2770808 197..545 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:05 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2770137..2770191 1..54 98 -> Plus
arm_2L 2770259..2770400 55..196 100 -> Plus
arm_2L 2770460..2770808 197..545 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:58:06 Download gff for RH49748.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2770460..2770808 197..545 100   Plus
2L 2770137..2770191 1..54 98 -> Plus
2L 2770259..2770400 55..196 100 -> Plus

RH49748.hyp Sequence

Translation from 0 to 465

> RH49748.hyp
SAISMFLSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAASEDTIFGKI
LRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDAD
LLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQ
WPPG*

RH49748.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG2862-PC 150 CG2862-PC 1..150 5..154 785 100 Plus
CG2862-PA 150 CG2862-PA 1..150 5..154 785 100 Plus
CG2862-PB 126 CG2862-PB 1..126 29..154 665 100 Plus

RH49748.pep Sequence

Translation from 13 to 465

> RH49748.pep
MFLSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAASEDTIFGKILRKE
IPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGH
LMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG
*

RH49748.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13894-PA 178 GF13894-PA 1..120 1..120 547 86.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24885-PA 150 GG24885-PA 1..150 1..150 777 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13108-PA 150 GH13108-PA 1..150 1..150 678 82.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG2862-PC 150 CG2862-PC 1..150 1..150 785 100 Plus
CG2862-PA 150 CG2862-PA 1..150 1..150 785 100 Plus
CG2862-PB 126 CG2862-PB 1..126 25..150 665 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22541-PA 150 GI22541-PA 1..150 1..150 669 82 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26584-PA 156 GL26584-PA 1..115 25..139 554 90.4 Plus
Dper\GL13047-PA 70 GL13047-PA 34..70 110..146 153 75.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15490-PA 126 GA15490-PA 1..126 25..150 624 91.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18366-PA 150 GM18366-PA 1..150 1..150 801 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23182-PA 150 GD23182-PA 1..150 1..150 801 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23055-PA 150 GJ23055-PA 1..150 1..150 693 85.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:06:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18243-PA 151 GK18243-PA 1..151 1..150 651 79.5 Plus