BDGP Sequence Production Resources |
Search the DGRC for RH49748
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 497 |
Well: | 48 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG2862-RA |
Protein status: | RH49748.pep: gold |
Preliminary Size: | 596 |
Sequenced Size: | 560 |
Gene | Date | Evidence |
---|---|---|
CG2862 | 2001-12-17 | Blastp of sequenced clone |
CG2862 | 2002-01-01 | Sim4 clustering to Release 2 |
CG2862 | 2003-01-01 | Sim4 clustering to Release 3 |
CG2862 | 2008-04-29 | Release 5.5 accounting |
CG2862 | 2008-08-15 | Release 5.9 accounting |
CG2862 | 2008-12-18 | 5.12 accounting |
560 bp (560 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071745
> RH49748.complete GAGCGCTATTTCGATGTTCTTGTCAACCGGCCGGAATTTCTTTCGTGTTT TCAGCTCTCGCCAAATAGCAAGCTGCAGTGCTAGAATGGCAAGCGAAGTG GAAAAATCGCAAACGGCAGCCGCCAGTGAAGACACCATTTTCGGCAAGAT TTTGCGCAAGGAGATCCCATGCAAATTTATCCACGAGGATGATAAATGCG TTGCCTTCCACGATGTGGCGCCCCAGGCACCAACCCACTTCCTCGTGATT CCTCGCAAGCCAATTGCCCAACTCTCGCTAGCCGAGGATGGAGATGCCGA TCTGCTGGGACATCTCATGCTGGTGGGCCGCAAGGTGGCCAAGGAGCTCG GCCTCGCGGATGGCTACCGCGTGGTCATCAACAATGGCAAGCACGGCGCC CAGTCAGTTTACCACTTGCATTTGCACTTCCTCGGCGGCCGCCAGATGCA GTGGCCACCAGGATAAGAAGCAGCCGATGGTGCAGCTACCAGATCCAAGA TCATTTACACCACAGAGAATTTTTGAAATAAACTATGTGAAATGCAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2862.a | 782 | CG2862.a | 143..691 | 2..550 | 2730 | 99.8 | Plus |
CG2862-RA | 684 | CG2862-RA | 45..593 | 2..550 | 2730 | 99.8 | Plus |
CG2862-RB | 703 | CG2862-RB | 114..612 | 52..550 | 2480 | 99.7 | Plus |
CG2862-RB | 703 | CG2862-RB | 1..49 | 6..54 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 2770182..2770530 | 197..545 | 1745 | 100 | Plus |
chr2L | 23010047 | chr2L | 2769977..2770121 | 52..196 | 710 | 99.3 | Plus |
chr2L | 23010047 | chr2L | 2769860..2769912 | 2..54 | 265 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 2769858..2769912 | 1..54 | 98 | -> | Plus |
chr2L | 2769980..2770121 | 55..196 | 99 | -> | Plus |
chr2L | 2770182..2770530 | 197..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..453 | 14..466 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..453 | 14..466 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..453 | 14..466 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..453 | 14..466 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..453 | 14..466 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..546 | 1..545 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 2..547 | 1..545 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 3..548 | 1..545 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 1..546 | 1..545 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG2862-RA | 3..548 | 1..545 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2770137..2770191 | 1..54 | 98 | -> | Plus |
2L | 2770259..2770400 | 55..196 | 100 | -> | Plus |
2L | 2770460..2770808 | 197..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2770137..2770191 | 1..54 | 98 | -> | Plus |
2L | 2770259..2770400 | 55..196 | 100 | -> | Plus |
2L | 2770460..2770808 | 197..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2770137..2770191 | 1..54 | 98 | -> | Plus |
2L | 2770259..2770400 | 55..196 | 100 | -> | Plus |
2L | 2770460..2770808 | 197..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 2770137..2770191 | 1..54 | 98 | -> | Plus |
arm_2L | 2770259..2770400 | 55..196 | 100 | -> | Plus |
arm_2L | 2770460..2770808 | 197..545 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 2770460..2770808 | 197..545 | 100 | Plus | |
2L | 2770137..2770191 | 1..54 | 98 | -> | Plus |
2L | 2770259..2770400 | 55..196 | 100 | -> | Plus |
Translation from 0 to 465
> RH49748.hyp SAISMFLSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAASEDTIFGKI LRKEIPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDAD LLGHLMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQ WPPG*
Translation from 13 to 465
> RH49748.pep MFLSTGRNFFRVFSSRQIASCSARMASEVEKSQTAAASEDTIFGKILRKE IPCKFIHEDDKCVAFHDVAPQAPTHFLVIPRKPIAQLSLAEDGDADLLGH LMLVGRKVAKELGLADGYRVVINNGKHGAQSVYHLHLHFLGGRQMQWPPG *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13894-PA | 178 | GF13894-PA | 1..120 | 1..120 | 547 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24885-PA | 150 | GG24885-PA | 1..150 | 1..150 | 777 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13108-PA | 150 | GH13108-PA | 1..150 | 1..150 | 678 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG2862-PC | 150 | CG2862-PC | 1..150 | 1..150 | 785 | 100 | Plus |
CG2862-PA | 150 | CG2862-PA | 1..150 | 1..150 | 785 | 100 | Plus |
CG2862-PB | 126 | CG2862-PB | 1..126 | 25..150 | 665 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22541-PA | 150 | GI22541-PA | 1..150 | 1..150 | 669 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26584-PA | 156 | GL26584-PA | 1..115 | 25..139 | 554 | 90.4 | Plus |
Dper\GL13047-PA | 70 | GL13047-PA | 34..70 | 110..146 | 153 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15490-PA | 126 | GA15490-PA | 1..126 | 25..150 | 624 | 91.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18366-PA | 150 | GM18366-PA | 1..150 | 1..150 | 801 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23182-PA | 150 | GD23182-PA | 1..150 | 1..150 | 801 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23055-PA | 150 | GJ23055-PA | 1..150 | 1..150 | 693 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18243-PA | 151 | GK18243-PA | 1..151 | 1..150 | 651 | 79.5 | Plus |