Clone RH49821 Report

Search the DGRC for RH49821

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:498
Well:21
Vector:pFlc-1
Associated Gene/Transcriptyellow-d2-RA
Protein status:RH49821.pep: gold
Preliminary Size:1266
Sequenced Size:1354

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9891 2002-01-01 Sim4 clustering to Release 2
CG9891 2002-06-11 Blastp of sequenced clone
CG9891 2003-01-01 Sim4 clustering to Release 3
yellow-d2 2008-04-29 Release 5.5 accounting
yellow-d2 2008-08-15 Release 5.9 accounting
yellow-d2 2008-12-18 5.12 accounting

Clone Sequence Records

RH49821.complete Sequence

1354 bp (1354 high quality bases) assembled on 2002-06-11

GenBank Submission: AY121706

> RH49821.complete
GGCAGTATCCGCTCGGTGTTTAAGTGGAACAGTTGTCGCGAAAGTGAAAG
GATTACGGCATGGAGCGTTGGATTGTCTTCGGTGTCTGCTGTTGGTGCTG
GCTGGCAGCATCCGCCCAGGCCTTGGAAAGTGTCTTTGGAGCCTACAATC
TGGAGCTGGAGTTTCCATCGCCGCAGGAAAGACAGCGCGCGCTGAGAGAT
GGACTATACGATCCGGGCAGCGTGATCCCCATCGATGTGGACGTCTACTA
CAAGCATGGCGATGCCACACCCTCGATATTCGTGACCATTCCGCGTTTTG
CCAAGGGCGTTCCATACTCTCTGGCCTACGTCACAAACGAAATGCGACCG
AACGGGACTCTCCTGCAGGCTTATCCCAGCTACGAGTGGCACAAATCCCA
CGGAGCCGACTGCAATGGATTGACTTCGGTGTACCGCACACAGATAGACG
AGTGCGGGCGCATGTGGATCCTGGACAGCGGCGAGATCGACTTCATTCAG
CACTGCCCGCCGCAGCTGTACGCTATTGACTTGGAAAGCGGAAAAGTCGC
GCATCAGTACAAGATGCCCAAGCGATTGTACAAGGAGGGCGTGAGTCGCT
TTGTCACGCCCACCGTGGAGCTGGATCCGCACAACTGCGATGTGGGATTC
GTGTACATGGCGGACTCCATTGGAGACGGCATTGTGGTGTATGACGTGGC
AGCCCAGCAGTCGTGGCGGATTGAGAACAAGTTTACGTATCCTCATCCAG
ACTTCGGCACATTCACGATAGCAGGCGAGAGCTTCCAGCTGTGGGACGGC
ACGGTGTCTACCACTCTAACGCCCCACGGCTTGGGTGGCCGGCGGATGAT
GTATTTCCACTCTCTGTCCAGCGAGTGGCAAATGGCCATTCCGTTGGATG
TGGTCAACAACGGCAGCAACTGGCGGCTGAACGATGTGAGCGCTGCCTTG
GATCAGTTCCAGTTGCTGGGCAAGCGGGGAAGTCAATGCGTTGCGGCGGC
CATGAGCGAGTCCGGCTTTCTGATCTGCGGCCTGGTCCAGCCGGCCAGCC
TTTTGGCCTGGAACATTCGCACCGGCTACAGCCATCAGAATCTGGTCATG
CTGGTGGAGGATGAGCAGCGACTGCAGTTCGCCAGTGGACTCAAGATAGT
GCGCAACCACGAGGGCAAGGAGGAACTGTGGGTGCTGTCGAATCGGCTGC
AGAAAGCCTTCGGAGCGGGTCTGGACTACAAGGAGATAAACTTTCGCATA
CAGAAGTGCGGTGTTCAGGAGCTGCTCAGCGGCAGGCCTTGCAACTGAGT
CGCTTCCCGCTGCTGCTCAATAAAGCTAATGATGAAATAAAAAAAAAAAA
AAAA

RH49821.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-d2-RA 1543 yellow-d2-RA 198..1536 2..1340 6695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19267827..19268909 256..1338 5385 99.8 Plus
chr2R 21145070 chr2R 19267519..19267772 2..255 1240 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23381509..23382593 256..1340 5425 100 Plus
2R 25286936 2R 23381201..23381454 2..255 1270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23382708..23383792 256..1340 5425 100 Plus
2R 25260384 2R 23382400..23382653 2..255 1270 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:35:22 has no hits.

RH49821.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:36:05 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19267517..19267772 1..255 98 -> Plus
chr2R 19267827..19268909 256..1338 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:47 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1239 60..1298 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:39 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1239 60..1298 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:28 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1239 60..1298 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:14 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1239 60..1298 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:06 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1239 60..1298 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:13 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1339 1..1338 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:39 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1339 1..1338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:28 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 3..1341 1..1338 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:15 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 1..1339 1..1338 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:06 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-d2-RA 3..1341 1..1338 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:05 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23381199..23381454 1..255 99 -> Plus
2R 23381509..23382591 256..1338 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:05 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23381199..23381454 1..255 99 -> Plus
2R 23381509..23382591 256..1338 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:05 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23381199..23381454 1..255 99 -> Plus
2R 23381509..23382591 256..1338 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:28 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19268722..19268977 1..255 99 -> Plus
arm_2R 19269032..19270114 256..1338 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:19 Download gff for RH49821.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23382416..23382671 1..255 99 -> Plus
2R 23382726..23383808 256..1338 100   Plus

RH49821.pep Sequence

Translation from 59 to 1297

> RH49821.pep
MERWIVFGVCCWCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLY
DPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMRPNGT
LLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCP
PQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYM
ADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVS
TTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQF
QLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVE
DEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKC
GVQELLSGRPCN*

RH49821.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11858-PA 411 GF11858-PA 1..410 1..411 2025 90 Plus
Dana\GF19909-PA 404 GF19909-PA 8..403 20..411 1133 53.1 Plus
Dana\GF11856-PA 428 GF11856-PA 39..412 31..408 793 42.1 Plus
Dana\GF17381-PA 418 GF17381-PA 54..409 56..412 621 35.4 Plus
Dana\y-PA 546 GF21448-PA 23..408 18..412 428 28.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22850-PA 412 GG22850-PA 1..411 1..411 2147 96.1 Plus
Dere\GG17051-PA 440 GG17051-PA 39..439 15..411 1110 51.7 Plus
Dere\GG22849-PA 429 GG22849-PA 39..412 31..408 794 41.4 Plus
Dere\GG17052-PA 409 GG17052-PA 32..397 44..411 586 34.8 Plus
Dere\GG16380-PA 459 GG16380-PA 45..437 18..412 501 29.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21216-PA 431 GH21216-PA 9..430 3..411 1683 73.2 Plus
Dgri\GH21214-PA 428 GH21214-PA 39..415 17..399 854 43.4 Plus
Dgri\GH21215-PA 446 GH21215-PA 47..430 21..408 845 42.6 Plus
Dgri\GH18543-PA 416 GH18543-PA 55..407 56..411 619 35 Plus
Dgri\GH23996-PA 455 GH23996-PA 55..433 31..412 505 32.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-d2-PA 412 CG9891-PA 1..412 1..412 2224 100 Plus
yellow-e2-PB 435 CG17044-PB 44..434 25..411 1123 53.3 Plus
yellow-d-PA 432 CG9889-PA 43..416 31..408 769 41.4 Plus
yellow-e3-PA 409 CG17045-PA 32..397 44..411 581 35.1 Plus
yellow-h-PA 463 CG1629-PA 49..441 18..412 463 29 Plus
yellow-b-PB 453 CG17914-PB 13..402 16..411 428 29.2 Plus
yellow-b-PA 453 CG17914-PA 13..402 16..411 428 29.2 Plus
y-PA 541 CG3757-PA 7..406 4..412 428 27.4 Plus
yellow-c-PB 438 CG4182-PB 23..436 17..411 377 26.8 Plus
yellow-c-PA 438 CG4182-PA 23..436 17..411 377 26.8 Plus
yellow-e-PA 530 CG9792-PA 67..385 73..397 341 27.9 Plus
yellow-f-PC 413 CG18550-PC 74..398 73..397 326 26.8 Plus
yellow-f-PB 418 CG18550-PB 79..403 73..397 326 26.8 Plus
yellow-f-PA 429 CG18550-PA 90..414 73..397 326 26.8 Plus
yellow-f2-PA 452 CG8063-PA 113..439 73..399 304 26.3 Plus
yellow-g-PA 393 CG5717-PA 46..236 23..221 184 27.1 Plus
yellow-g2-PA 382 CG13804-PA 45..226 32..221 175 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20502-PA 429 GI20502-PA 34..429 19..412 1738 78.5 Plus
Dmoj\GI20501-PA 443 GI20501-PA 1..427 1..408 808 39.1 Plus
Dmoj\GI23242-PA 408 GI23242-PA 52..401 56..411 622 36.1 Plus
Dmoj\GI11002-PA 470 GI11002-PA 65..447 31..412 503 31.1 Plus
Dmoj\GI17054-PA 454 GI17054-PA 6..401 5..411 443 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17571-PA 418 GL17571-PA 2..417 1..411 1907 83.7 Plus
Dper\GL23986-PA 429 GL23986-PA 31..426 20..411 1134 52.9 Plus
Dper\GL17570-PA 434 GL17570-PA 33..417 20..408 803 42 Plus
Dper\GL23987-PA 409 GL23987-PA 43..396 56..412 615 36.8 Plus
Dper\GL18156-PA 466 GL18156-PA 64..444 31..412 515 31.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22105-PA 422 GA22105-PA 2..421 1..411 1891 82.6 Plus
Dpse\GA14291-PB 426 GA14291-PB 28..423 20..411 1144 52.9 Plus
Dpse\GA22103-PA 434 GA22103-PA 33..417 20..408 803 42 Plus
Dpse\GA14292-PA 409 GA14292-PA 43..396 56..412 615 36.8 Plus
Dpse\GA27858-PA 427 GA27858-PA 25..405 31..412 519 32.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16008-PA 412 GM16008-PA 1..412 1..412 2171 97.3 Plus
Dsec\GM25936-PA 426 GM25936-PA 35..425 25..411 1128 53.6 Plus
Dsec\GM16007-PA 430 GM16007-PA 41..414 31..408 795 41.4 Plus
Dsec\GM25937-PA 409 GM25937-PA 32..397 44..411 601 35.1 Plus
Dsec\GM17203-PA 453 GM17203-PA 13..402 16..411 435 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11759-PA 412 GD11759-PA 1..412 1..412 2209 99 Plus
Dsim\GD20498-PA 426 GD20498-PA 35..425 25..411 1132 53.6 Plus
Dsim\GD11758-PA 432 GD11758-PA 43..416 31..408 795 41.4 Plus
Dsim\GD20499-PA 387 GD20499-PA 32..343 44..357 473 33.5 Plus
Dsim\GD24079-PA 453 GD24079-PA 13..402 16..411 434 29.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:47:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22352-PA 430 GJ22352-PA 35..429 19..411 1745 79.2 Plus
Dvir\GJ22351-PA 453 GJ22351-PA 48..437 15..408 819 41 Plus
Dvir\GJ10739-PA 415 GJ10739-PA 50..406 53..412 631 35.9 Plus
Dvir\GJ14923-PA 455 GJ14923-PA 51..433 31..412 541 32.6 Plus
Dvir\GJ17304-PA 466 GJ17304-PA 7..404 4..411 446 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23285-PA 422 GK23285-PA 28..421 20..411 1871 86.5 Plus
Dwil\GK13343-PA 420 GK13343-PA 16..415 16..411 1166 52.9 Plus
Dwil\GK23284-PA 446 GK23284-PA 57..430 31..408 861 45 Plus
Dwil\GK13344-PA 401 GK13344-PA 42..387 56..411 591 36.2 Plus
Dwil\GK13672-PA 468 GK13672-PA 47..434 15..402 491 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14285-PA 412 GE14285-PA 1..411 1..411 2158 97.1 Plus
Dyak\GE24439-PA 440 GE24439-PA 49..439 25..411 1111 53.3 Plus
Dyak\GE14284-PA 430 GE14284-PA 41..414 31..408 801 41.9 Plus
Dyak\GE24440-PA 411 GE24440-PA 32..399 44..411 608 35.4 Plus
Dyak\GE14541-PA 463 GE14541-PA 44..441 12..412 509 30.1 Plus

RH49821.hyp Sequence

Translation from 59 to 1297

> RH49821.hyp
MERWIVFGVCCWCWLAASAQALESVFGAYNLELEFPSPQERQRALRDGLY
DPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEMRPNGT
LLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCP
PQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYM
ADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVS
TTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQF
QLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVE
DEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKC
GVQELLSGRPCN*

RH49821.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-d2-PA 412 CG9891-PA 1..412 1..412 2224 100 Plus
yellow-e2-PB 435 CG17044-PB 44..434 25..411 1123 53.3 Plus
yellow-d-PA 432 CG9889-PA 43..416 31..408 769 41.4 Plus
yellow-e3-PA 409 CG17045-PA 32..397 44..411 581 35.1 Plus
yellow-h-PA 463 CG1629-PA 49..441 18..412 463 29 Plus