BDGP Sequence Production Resources |
Search the DGRC for RH50436
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 504 |
Well: | 36 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Nf-YB-RA |
Protein status: | RH50436.pep: gold |
Preliminary Size: | 552 |
Sequenced Size: | 934 |
Gene | Date | Evidence |
---|---|---|
CG10447 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10447 | 2002-03-28 | Blastp of sequenced clone |
CG10447 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10447 | 2008-04-29 | Release 5.5 accounting |
CG10447 | 2008-08-15 | Release 5.9 accounting |
CG10447 | 2008-12-18 | 5.12 accounting |
934 bp (934 high quality bases) assembled on 2002-03-28
GenBank Submission: AY094930
> RH50436.complete GATCGATTGACGATAGCCCTCGCAATTTGGGAAAGTAAACAAAAGCAAAT CCGTTGAAGAAATCTGTTAAAAATCCAAGATATGAGCAATAGCGAGGACT CGCAGCAGTATCTGAACGACATGCTGGTCAAGGAGGAGGACGAGGCGTCC GGCGACGATTCGGACAAACAGGATGGAGGGATAATGCTACGCGAACAGGA CCGATTTCTGCCCATCTGCAACATCATTAAGATCATGAAGGTTCCGGTGC CCCAGAACGGCAAGATAGCCAAGGATGCACGAGAGTGCATCCAGGAGTGT GTCTCCGAGTTCATATCCTTCATTAGCAGTGAGGCCATCGAACGTAGCGT CGCGGAGAATCGCAAGACAGTCAACGGGGACGACCTGCTGGTGGCGTTCA GCAATCTGGGATTCGACAATTACGTGGAACCACTGTCCATTTACCTGCAA AAGTACCGAGAGTCGAACAAATCGGATCGTAATCTCTTTCTGGACGCCAG TTATCCGCACAACGAAGATGGGTCCTCCGCAAACGATGCGGGGAAACAGT AACCCCTTTCTTACTTACCCTGTTAGTTAAGGTTCTTTTGACATTAAGGA AATATTTGTCTAATTCAAAGTGTTTTGTTTAATCCTAACAGTACACCTTG ATTGACTATTTAAGTTAATATTATCATTACTATTCTTTCTGATTATTTAA TTTTTTATTTTGTATATATGATATATGATTTTATTTTAATTGTAACCACA GATTTTATATGCATAAATCCATTTTTACTCTCCCGATACATAGTCAAATT CAATATTTAGGTCTTGGTACTGGTAGCAAACATGAATTTATGTATCGCGG GCCCATTAAGCCAAATTACTGATACTCTTATATAAAATAAATATGTTTAT TTAGTAAACATTAATATAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 19735155..19735611 | 461..917 | 2285 | 100 | Plus |
chr2L | 23010047 | chr2L | 19734795..19735103 | 154..462 | 1545 | 100 | Plus |
chr2L | 23010047 | chr2L | 19734579..19734731 | 2..154 | 765 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19736632..19737093 | 461..922 | 2310 | 100 | Plus |
2L | 23513712 | 2L | 19736272..19736580 | 154..462 | 1545 | 100 | Plus |
2L | 23513712 | 2L | 19736056..19736208 | 2..154 | 765 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19736632..19737093 | 461..922 | 2310 | 100 | Plus |
2L | 23513712 | 2L | 19736272..19736580 | 154..462 | 1545 | 100 | Plus |
2L | 23513712 | 2L | 19736056..19736208 | 2..154 | 765 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
G5 | 4856 | G5 G5_DM 4856bp | 583..664 | 179..96 | 135 | 65.5 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19734578..19734731 | 1..154 | 99 | -> | Plus |
chr2L | 19734796..19735103 | 155..462 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10447-RA | 1..471 | 82..552 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 1..471 | 82..552 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 1..471 | 82..552 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10447-RA | 1..471 | 82..552 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 1..471 | 82..552 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10447-RA | 2..917 | 2..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 14..930 | 1..917 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 12..928 | 1..917 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10447-RA | 2..917 | 2..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Nf-YB-RA | 12..928 | 1..917 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19736055..19736208 | 1..154 | 99 | -> | Plus |
2L | 19736273..19736580 | 155..462 | 100 | -> | Plus |
2L | 19736634..19737088 | 463..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19736055..19736208 | 1..154 | 99 | -> | Plus |
2L | 19736273..19736580 | 155..462 | 100 | -> | Plus |
2L | 19736634..19737088 | 463..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19736055..19736208 | 1..154 | 99 | -> | Plus |
2L | 19736273..19736580 | 155..462 | 100 | -> | Plus |
2L | 19736634..19737088 | 463..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19736055..19736208 | 1..154 | 99 | -> | Plus |
arm_2L | 19736273..19736580 | 155..462 | 100 | -> | Plus |
arm_2L | 19736634..19737088 | 463..917 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19736273..19736580 | 155..462 | 100 | -> | Plus |
2L | 19736634..19737088 | 463..917 | 100 | Plus | |
2L | 19736055..19736208 | 1..154 | 99 | -> | Plus |
Translation from 81 to 551
> RH50436.hyp MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIK IMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSA NDAGKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Nf-YB-PB | 156 | CG10447-PB | 1..156 | 1..156 | 801 | 100 | Plus |
Nf-YB-PA | 156 | CG10447-PA | 1..156 | 1..156 | 801 | 100 | Plus |
NC2beta-PA | 183 | CG4185-PA | 20..103 | 43..127 | 142 | 41.2 | Plus |
Translation from 81 to 551
> RH50436.pep MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIK IMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSA NDAGKQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14431-PA | 150 | GF14431-PA | 1..150 | 1..156 | 711 | 90.4 | Plus |
Dana\GF14900-PA | 183 | GF14900-PA | 20..90 | 43..114 | 142 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21205-PA | 156 | GG21205-PA | 1..156 | 1..156 | 804 | 98.7 | Plus |
Dere\GG25136-PA | 183 | GG25136-PA | 20..90 | 43..114 | 142 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13827-PA | 153 | GH13827-PA | 1..153 | 1..156 | 717 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Nf-YB-PB | 156 | CG10447-PB | 1..156 | 1..156 | 801 | 100 | Plus |
Nf-YB-PA | 156 | CG10447-PA | 1..156 | 1..156 | 801 | 100 | Plus |
NC2beta-PA | 183 | CG4185-PA | 20..103 | 43..127 | 142 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20193-PA | 154 | GI20193-PA | 1..154 | 1..156 | 726 | 90.4 | Plus |
Dmoj\GI13215-PA | 203 | GI13215-PA | 20..90 | 43..114 | 136 | 44.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26173-PA | 156 | GL26173-PA | 1..155 | 1..155 | 719 | 85.8 | Plus |
Dper\GL26021-PA | 183 | GL26021-PA | 20..90 | 43..114 | 142 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10323-PA | 156 | GA10323-PA | 1..155 | 1..155 | 719 | 85.8 | Plus |
Dpse\GA18013-PA | 183 | GA18013-PA | 20..90 | 43..114 | 142 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17376-PA | 156 | GM17376-PA | 1..156 | 1..156 | 807 | 98.7 | Plus |
Dsec\GM15851-PA | 183 | GM15851-PA | 20..90 | 43..114 | 143 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24231-PA | 129 | GD24231-PA | 1..129 | 1..156 | 624 | 81.4 | Plus |
Dsim\GD23986-PA | 183 | GD23986-PA | 20..90 | 43..114 | 143 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13578-PA | 154 | GJ13578-PA | 1..154 | 1..156 | 712 | 89.2 | Plus |
Dvir\GJ11838-PA | 179 | GJ11838-PA | 20..90 | 43..114 | 137 | 44.4 | Plus |