Clone RH50436 Report

Search the DGRC for RH50436

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:504
Well:36
Vector:pFlc-1
Associated Gene/TranscriptNf-YB-RA
Protein status:RH50436.pep: gold
Preliminary Size:552
Sequenced Size:934

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10447 2002-01-01 Sim4 clustering to Release 2
CG10447 2002-03-28 Blastp of sequenced clone
CG10447 2003-01-01 Sim4 clustering to Release 3
CG10447 2008-04-29 Release 5.5 accounting
CG10447 2008-08-15 Release 5.9 accounting
CG10447 2008-12-18 5.12 accounting

Clone Sequence Records

RH50436.complete Sequence

934 bp (934 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094930

> RH50436.complete
GATCGATTGACGATAGCCCTCGCAATTTGGGAAAGTAAACAAAAGCAAAT
CCGTTGAAGAAATCTGTTAAAAATCCAAGATATGAGCAATAGCGAGGACT
CGCAGCAGTATCTGAACGACATGCTGGTCAAGGAGGAGGACGAGGCGTCC
GGCGACGATTCGGACAAACAGGATGGAGGGATAATGCTACGCGAACAGGA
CCGATTTCTGCCCATCTGCAACATCATTAAGATCATGAAGGTTCCGGTGC
CCCAGAACGGCAAGATAGCCAAGGATGCACGAGAGTGCATCCAGGAGTGT
GTCTCCGAGTTCATATCCTTCATTAGCAGTGAGGCCATCGAACGTAGCGT
CGCGGAGAATCGCAAGACAGTCAACGGGGACGACCTGCTGGTGGCGTTCA
GCAATCTGGGATTCGACAATTACGTGGAACCACTGTCCATTTACCTGCAA
AAGTACCGAGAGTCGAACAAATCGGATCGTAATCTCTTTCTGGACGCCAG
TTATCCGCACAACGAAGATGGGTCCTCCGCAAACGATGCGGGGAAACAGT
AACCCCTTTCTTACTTACCCTGTTAGTTAAGGTTCTTTTGACATTAAGGA
AATATTTGTCTAATTCAAAGTGTTTTGTTTAATCCTAACAGTACACCTTG
ATTGACTATTTAAGTTAATATTATCATTACTATTCTTTCTGATTATTTAA
TTTTTTATTTTGTATATATGATATATGATTTTATTTTAATTGTAACCACA
GATTTTATATGCATAAATCCATTTTTACTCTCCCGATACATAGTCAAATT
CAATATTTAGGTCTTGGTACTGGTAGCAAACATGAATTTATGTATCGCGG
GCCCATTAAGCCAAATTACTGATACTCTTATATAAAATAAATATGTTTAT
TTAGTAAACATTAATATAAAAAAAAAAAAAAAAA

RH50436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-RA 1164 Nf-YB-RA 32..952 2..922 4605 100 Plus
Nf-YB.a 913 Nf-YB.a 167..913 171..917 3735 100 Plus
Nf-YB.a 913 Nf-YB.a 15..167 2..154 765 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19735155..19735611 461..917 2285 100 Plus
chr2L 23010047 chr2L 19734795..19735103 154..462 1545 100 Plus
chr2L 23010047 chr2L 19734579..19734731 2..154 765 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19736632..19737093 461..922 2310 100 Plus
2L 23513712 2L 19736272..19736580 154..462 1545 100 Plus
2L 23513712 2L 19736056..19736208 2..154 765 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19736632..19737093 461..922 2310 100 Plus
2L 23513712 2L 19736272..19736580 154..462 1545 100 Plus
2L 23513712 2L 19736056..19736208 2..154 765 100 Plus
Blast to na_te.dros performed 2019-03-15 16:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 583..664 179..96 135 65.5 Minus

RH50436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:45:00 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19734578..19734731 1..154 99 -> Plus
chr2L 19734796..19735103 155..462 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:53 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 1..471 82..552 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:22:46 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 1..471 82..552 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:28 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 1..471 82..552 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:59:20 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 1..471 82..552 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:35 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 1..471 82..552 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:49:42 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 2..917 2..917 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:22:46 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 14..930 1..917 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:28 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 12..928 1..917 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:59:20 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 2..917 2..917 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:35 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 12..928 1..917 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:45:00 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19736055..19736208 1..154 99 -> Plus
2L 19736273..19736580 155..462 100 -> Plus
2L 19736634..19737088 463..917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:45:00 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19736055..19736208 1..154 99 -> Plus
2L 19736273..19736580 155..462 100 -> Plus
2L 19736634..19737088 463..917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:45:00 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19736055..19736208 1..154 99 -> Plus
2L 19736273..19736580 155..462 100 -> Plus
2L 19736634..19737088 463..917 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:28 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19736055..19736208 1..154 99 -> Plus
arm_2L 19736273..19736580 155..462 100 -> Plus
arm_2L 19736634..19737088 463..917 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:32:10 Download gff for RH50436.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19736273..19736580 155..462 100 -> Plus
2L 19736634..19737088 463..917 100   Plus
2L 19736055..19736208 1..154 99 -> Plus

RH50436.hyp Sequence

Translation from 81 to 551

> RH50436.hyp
MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIK
IMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD
DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSA
NDAGKQ*

RH50436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-PB 156 CG10447-PB 1..156 1..156 801 100 Plus
Nf-YB-PA 156 CG10447-PA 1..156 1..156 801 100 Plus
NC2beta-PA 183 CG4185-PA 20..103 43..127 142 41.2 Plus

RH50436.pep Sequence

Translation from 81 to 551

> RH50436.pep
MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIK
IMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD
DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSA
NDAGKQ*

RH50436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14431-PA 150 GF14431-PA 1..150 1..156 711 90.4 Plus
Dana\GF14900-PA 183 GF14900-PA 20..90 43..114 142 45.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21205-PA 156 GG21205-PA 1..156 1..156 804 98.7 Plus
Dere\GG25136-PA 183 GG25136-PA 20..90 43..114 142 45.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13827-PA 153 GH13827-PA 1..153 1..156 717 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-PB 156 CG10447-PB 1..156 1..156 801 100 Plus
Nf-YB-PA 156 CG10447-PA 1..156 1..156 801 100 Plus
NC2beta-PA 183 CG4185-PA 20..103 43..127 142 41.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20193-PA 154 GI20193-PA 1..154 1..156 726 90.4 Plus
Dmoj\GI13215-PA 203 GI13215-PA 20..90 43..114 136 44.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26173-PA 156 GL26173-PA 1..155 1..155 719 85.8 Plus
Dper\GL26021-PA 183 GL26021-PA 20..90 43..114 142 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10323-PA 156 GA10323-PA 1..155 1..155 719 85.8 Plus
Dpse\GA18013-PA 183 GA18013-PA 20..90 43..114 142 45.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17376-PA 156 GM17376-PA 1..156 1..156 807 98.7 Plus
Dsec\GM15851-PA 183 GM15851-PA 20..90 43..114 143 45.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24231-PA 129 GD24231-PA 1..129 1..156 624 81.4 Plus
Dsim\GD23986-PA 183 GD23986-PA 20..90 43..114 143 45.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13578-PA 154 GJ13578-PA 1..154 1..156 712 89.2 Plus
Dvir\GJ11838-PA 179 GJ11838-PA 20..90 43..114 137 44.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14923-PA 156 GK14923-PA 1..156 1..156 735 89.1 Plus
Dwil\GK18069-PA 179 GK18069-PA 20..90 43..114 139 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13279-PA 156 GE13279-PA 1..156 1..156 804 98.1 Plus
Dyak\GE19055-PA 183 GE19055-PA 20..90 43..114 143 45.8 Plus