Clone RH50933 Report

Search the DGRC for RH50933

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:509
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG30503-RA
Protein status:RH50933.pep: gold
Preliminary Size:522
Sequenced Size:756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1672 2002-01-01 Sim4 clustering to Release 2
CG30503 2002-03-28 Blastp of sequenced clone
CG30503 2008-04-29 Release 5.5 accounting
kappaB-Ras 2008-08-15 Release 5.9 accounting
CG30503 2008-08-15 Release 5.9 accounting
CG30503 2008-12-18 5.12 accounting
kappaB-Ras 2008-12-18 5.12 accounting

Clone Sequence Records

RH50933.complete Sequence

756 bp (756 high quality bases) assembled on 2002-03-28

GenBank Submission: AY094932

> RH50933.complete
GAGTCGTCTGCAAGCCCCTTCCTCGAGCGCAATGCTTTCGCGTGCCGCTT
TTCTTACTGTTCTCCTAACGCTGATCTATGCCAGCCATGCGGCTGCGGGA
TTGAGCATTACAGTTCCGGGCACAAAGTGGTGTGGACCCGGGAACATAGC
AGCCAACTACGATGACCTGGGCACTGAGCGCGAAGTGGACACGTGCTGCC
GGGCGCACGACAACTGTGAGGAGAAGATTCCGCCGCTGGAGGAAGCCTTT
GGCCTGAGAAACGACGGGTTTTTCCCCATATTCTCGTGTGCCTGCGAGTC
GGCCTTCCGGAACTGCCTCACCGCTCTGCGAAACGGACACTCCCTGGCTC
TTGGCAAAATCTACTTCAACACCAAGGAGGTGTGCTTTGGCTACGGGCAT
CCCATCGTTTCCTGCCAGGAGAAGCAGGCCGACCTGTTCGAGACACGATG
TCTCAGCTACCGAGTGGACGAAGGTCAGCCGCAGCGCTGGCAGTTCTACG
ACTTGGCCCTCTACACACACGTAAGCGGCAGCGAGGAGGACTCCCGAGAT
TGAACTTCGACGTCCGGCGATAAGCCCTCAATTGTTTACAAAACAGATTG
TGCGGGGAGCGAAACCTAATGTGATTAGGATTTTGACGGTAGGTTATTTG
TGTAATAAATTTTCGAAGCTTAAGGCTAAGTAGCCTGGAATTATATTAAA
AACTGAATTCGGAGGCTCAATTAAAGTTCAAAATGATCAAGAAAAAAAAA
AAAAAA

RH50933.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30503-RA 818 CG30503-RA 75..818 2..745 3720 100 Plus
kappaB-Ras-RB 1815 kappaB-Ras-RB 1072..1815 2..745 3720 100 Plus
CG30503-RB 1815 CG30503-RB 1072..1815 2..745 3720 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3331178..3331639 741..280 2310 100 Minus
chr2R 21145070 chr2R 3331703..3331980 279..2 1390 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443820..7444285 745..280 2330 100 Minus
2R 25286936 2R 7444349..7444626 279..2 1390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7445019..7445484 745..280 2330 100 Minus
2R 25260384 2R 7445548..7445825 279..2 1390 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:12:13 has no hits.

RH50933.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:15 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3331178..3331639 280..741 100 <- Minus
chr2R 3331703..3331980 1..279 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:48:56 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1..522 32..553 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:19:16 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1..522 32..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:13 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RA 1..522 32..553 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:10:18 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1..522 32..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:01:08 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RA 1..522 32..553 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:44:33 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1071..1811 1..741 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:19:16 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1071..1811 1..741 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:13 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RA 2..741 2..741 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:10:20 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
CG30503-RB 1071..1811 1..741 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:01:08 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
kappaB-Ras-RB 1102..1842 1..741 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:15 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443824..7444285 280..741 100 <- Minus
2R 7444349..7444626 1..279 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:15 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443824..7444285 280..741 100 <- Minus
2R 7444349..7444626 1..279 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:15 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443824..7444285 280..741 100 <- Minus
2R 7444349..7444626 1..279 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:13 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3331329..3331790 280..741 100 <- Minus
arm_2R 3331854..3332131 1..279 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:42:36 Download gff for RH50933.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7445023..7445484 280..741 100 <- Minus
2R 7445548..7445825 1..279 99   Minus

RH50933.hyp Sequence

Translation from 0 to 552

> RH50933.hyp
SRLQAPSSSAMLSRAAFLTVLLTLIYASHAAAGLSITVPGTKWCGPGNIA
ANYDDLGTEREVDTCCRAHDNCEEKIPPLEEAFGLRNDGFFPIFSCACES
AFRNCLTALRNGHSLALGKIYFNTKEVCFGYGHPIVSCQEKQADLFETRC
LSYRVDEGQPQRWQFYDLALYTHVSGSEEDSRD*

RH50933.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30503-PB 173 CG30503-PB 1..173 11..183 942 100 Plus
CG30503-PA 173 CG30503-PA 1..173 11..183 942 100 Plus
sPLA2-PC 186 CG11124-PC 43..180 36..172 396 50 Plus
sPLA2-PA 186 CG11124-PA 43..180 36..172 396 50 Plus
CG3009-PD 239 CG3009-PD 92..196 26..129 225 42.9 Plus

RH50933.pep Sequence

Translation from 31 to 552

> RH50933.pep
MLSRAAFLTVLLTLIYASHAAAGLSITVPGTKWCGPGNIAANYDDLGTER
EVDTCCRAHDNCEEKIPPLEEAFGLRNDGFFPIFSCACESAFRNCLTALR
NGHSLALGKIYFNTKEVCFGYGHPIVSCQEKQADLFETRCLSYRVDEGQP
QRWQFYDLALYTHVSGSEEDSRD*

RH50933.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11953-PA 172 GF11953-PA 1..172 1..173 675 69.9 Plus
Dana\GF12957-PA 186 GF12957-PA 43..180 26..162 391 50.7 Plus
Dana\GF22231-PA 309 GF22231-PA 184..290 11..117 217 40.2 Plus
Dana\GF20851-PA 330 GF20851-PA 87..227 16..163 212 36.9 Plus
Dana\GF21312-PA 204 GF21312-PA 71..177 26..131 180 36.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10751-PA 173 GG10751-PA 1..173 1..173 847 89.6 Plus
Dere\GG23279-PA 186 GG23279-PA 43..180 26..162 378 48.6 Plus
Dere\GG17755-PA 309 GG17755-PA 184..290 11..117 218 40.2 Plus
Dere\GG18524-PA 342 GG18524-PA 92..232 16..163 210 36.9 Plus
Dere\GG19301-PA 217 GG19301-PA 84..190 26..130 186 35.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20736-PA 172 GH20736-PA 2..167 4..171 558 62.5 Plus
Dgri\GH21166-PA 189 GH21166-PA 43..183 26..165 379 49.6 Plus
Dgri\GH12690-PA 321 GH12690-PA 209..302 24..117 218 42.6 Plus
Dgri\GH17900-PA 337 GH17900-PA 92..233 16..164 210 36.2 Plus
Dgri\GH24101-PA 230 GH24101-PA 104..207 29..131 175 34.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG30503-PB 173 CG30503-PB 1..173 1..173 942 100 Plus
CG30503-PA 173 CG30503-PA 1..173 1..173 942 100 Plus
sPLA2-PC 186 CG11124-PC 43..180 26..162 396 50 Plus
sPLA2-PA 186 CG11124-PA 43..180 26..162 396 50 Plus
CG3009-PB 342 CG3009-PB 92..232 16..163 227 36.9 Plus
CG3009-PA 342 CG3009-PA 92..232 16..163 227 36.9 Plus
CG3009-PD 239 CG3009-PD 92..196 16..119 225 42.9 Plus
CG42237-PB 309 CG42237-PB 184..290 11..117 219 40.2 Plus
CG42237-PA 363 CG4346-PA 238..344 11..117 219 40.2 Plus
sPLA2-PB 101 CG11124-PB 43..101 26..83 199 62.7 Plus
GIIIspla2-PC 217 CG1583-PC 84..205 26..145 194 33.6 Plus
GIIIspla2-PB 217 CG1583-PB 84..205 26..145 194 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20819-PA 165 GI20819-PA 3..164 5..168 574 65.2 Plus
Dmoj\GI18761-PA 184 GI18761-PA 43..180 26..162 377 47.8 Plus
Dmoj\GI16365-PA 312 GI16365-PA 200..293 24..117 223 43.6 Plus
Dmoj\GI14370-PA 213 GI14370-PA 83..201 28..145 179 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10932-PA 168 GL10932-PA 22..168 23..169 632 73.5 Plus
Dper\GL11167-PA 186 GL11167-PA 43..180 26..162 386 50.7 Plus
Dper\GL14950-PA 352 GL14950-PA 184..324 11..149 219 36.9 Plus
Dper\GL14551-PA 359 GL14551-PA 88..197 16..124 211 41.8 Plus
Dper\GL20365-PA 206 GL20365-PA 75..183 26..133 177 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15891-PA 168 GA15891-PA 17..168 18..169 638 72.4 Plus
Dpse\GA10773-PA 186 GA10773-PA 43..180 26..162 386 50.7 Plus
Dpse\GA18124-PA 309 GA18124-PA 184..290 11..117 219 40.2 Plus
Dpse\GA15641-PA 334 GA15641-PA 88..203 16..130 212 40.5 Plus
Dpse\GA13978-PA 206 GA13978-PA 75..183 26..133 177 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20797-PA 173 GM20797-PA 1..173 1..173 870 92.5 Plus
Dsec\GM20955-PA 186 GM20955-PA 43..180 26..162 382 49.3 Plus
Dsec\GM11601-PA 363 GM11601-PA 238..344 11..117 218 40.2 Plus
Dsec\GM12671-PA 340 GM12671-PA 90..230 16..163 210 36.9 Plus
Dsec\GM11233-PA 218 GM11233-PA 85..206 26..145 188 33.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10259-PA 173 GD10259-PA 1..173 1..173 871 93.6 Plus
Dsim\GD10480-PA 186 GD10480-PA 43..180 26..162 383 49.3 Plus
Dsim\GD17099-PA 277 GD17099-PA 152..258 11..117 215 40.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20552-PA 166 GJ20552-PA 2..165 4..169 562 64.5 Plus
Dvir\GJ21785-PA 187 GJ21785-PA 38..180 21..162 393 50.3 Plus
Dvir\GJ16735-PA 321 GJ16735-PA 209..302 24..117 216 42.6 Plus
Dvir\GJ16381-PA 337 GJ16381-PA 91..215 16..139 212 38.4 Plus
Dvir\GJ19410-PA 229 GJ19410-PA 100..213 29..141 182 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22012-PA 157 GK22012-PA 5..156 18..169 520 64.1 Plus
Dwil\GK21320-PA 188 GK21320-PA 45..182 26..162 371 49.3 Plus
Dwil\GK17378-PA 314 GK17378-PA 193..295 15..117 218 39.8 Plus
Dwil\GK25148-PA 983 GK25148-PA 87..191 16..119 210 42.9 Plus
Dwil\GK19962-PA 206 GK19962-PA 76..169 28..119 182 37.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24036-PA 173 GE24036-PA 1..173 1..173 810 85.5 Plus
Dyak\GE19126-PA 186 GE19126-PA 43..180 26..162 389 50 Plus
Dyak\GE17044-PA 262 GE17044-PA 137..243 11..117 218 40.2 Plus
Dyak\GE16841-PA 345 GE16841-PA 92..233 16..164 205 36 Plus
Dyak\GE15768-PA 217 GE15768-PA 84..205 26..145 187 33.6 Plus