Clone RH51452 Report

Search the DGRC for RH51452

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:514
Well:52
Vector:pFlc-1
Associated Gene/TranscriptCG9350-RA
Protein status:RH51452.pep: gold
Preliminary Size:641
Sequenced Size:726

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9350 2002-01-01 Sim4 clustering to Release 2
CG9350 2002-01-09 Blastp of sequenced clone
CG9350 2003-01-01 Sim4 clustering to Release 3
CG9350 2008-04-29 Release 5.5 accounting
CG9350 2008-08-15 Release 5.9 accounting
CG9350 2008-12-18 5.12 accounting

Clone Sequence Records

RH51452.complete Sequence

726 bp (726 high quality bases) assembled on 2002-01-09

GenBank Submission: AY075551

> RH51452.complete
GTCCTTCTGCTCGTGTGTATACACTGGCGAACAGCTGTTTTTTGTCAATC
TCCGCCACAATAATTACGTAAATTTCGGCAGCAAACCATGTCGCTGCTCC
GTTCGAAATACTACGACCATCCCGATGGCGAGGATGCCTTTGGCAAGATC
GTGGCCACCAACAAGTACGCGGTATCCGCCGGCGTGGCCTGGTCCATGTT
CGACGTCCTGACGCTCTCCAAGCCGCAAGGATATCTGCCCACACTGGGCC
GTTTCGCCTACAACACGGGTCCGCTGATGGGCATGGCCACGGCGTTCACT
CTGACCACCCTGGTGGCCACAAATGCGCGCGGCAAGGACGATAAAATCAA
CTACCTGATCGGCGGTTTTGCGGCTGGCGGCGTCTTTGGAGCCTGGAAAC
ACAACCACGTAGCTGGTCTGTGCGCCGGCCTCTTCCTGGGCATCGCTGGT
GTCATCAAGAAGATGTCCATTGAACAGGGCTGGGAGTTCTTCCCAAACAC
ACCGATCAAGCAGTATGGTGGTCTGAACATTGCCGGAAACGACTGGACCA
TCATGGCCGATCCTCCCAAGAACTGGACCACGGAAAAGCCAAAGGAGTAA
AGAAGGCGTAAAGTCTAGTTTCCTATGTTTAGTTTAATGGTGATTCGATG
AGAGAAAGATTCGGCACTAACCGCTTGCCTTGCAACCGAATAAAAGCCAA
GTCAGAAGTGAAAAAAAAAAAAAAAA

RH51452.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9350-RA 922 CG9350-RA 23..732 2..711 3550 100 Plus
CG9350.b 2430 CG9350.b 23..732 2..711 3550 100 Plus
CG9350.a 698 CG9350.a 70..698 82..710 3145 100 Plus
CG9350.a 698 CG9350.a 4..69 2..67 330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16912246..16912517 439..710 1360 100 Plus
chr2R 21145070 chr2R 16911770..16912034 80..344 1325 100 Plus
chr2R 21145070 chr2R 16912092..16912187 345..440 480 100 Plus
chr2R 21145070 chr2R 16911512..16911591 2..81 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21025815..21026087 439..711 1365 100 Plus
2R 25286936 2R 21025339..21025603 80..344 1325 100 Plus
2R 25286936 2R 21025661..21025756 345..440 480 100 Plus
2R 25286936 2R 21025081..21025160 2..81 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21027014..21027286 439..711 1365 100 Plus
2R 25260384 2R 21026538..21026802 80..344 1325 100 Plus
2R 25260384 2R 21026860..21026955 345..440 480 100 Plus
2R 25260384 2R 21026280..21026359 2..81 400 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:46:50 has no hits.

RH51452.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:08 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16911511..16911591 1..81 98 -> Plus
chr2R 16911772..16912034 82..344 100 -> Plus
chr2R 16912092..16912186 345..439 100 -> Plus
chr2R 16912247..16912517 440..710 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:04 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..513 88..600 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:50 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..513 88..600 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:36 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..513 88..600 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:22 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..513 88..600 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:46 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..513 88..600 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:54 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..710 2..710 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:50 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..710 2..710 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:36 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 3..712 1..710 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:22 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 1..710 2..710 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:46 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
CG9350-RA 3..712 1..710 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:08 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21025080..21025160 1..81 98 -> Plus
2R 21025341..21025603 82..344 100 -> Plus
2R 21025661..21025755 345..439 100 -> Plus
2R 21025816..21026086 440..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:08 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21025080..21025160 1..81 98 -> Plus
2R 21025341..21025603 82..344 100 -> Plus
2R 21025661..21025755 345..439 100 -> Plus
2R 21025816..21026086 440..710 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:08 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21025080..21025160 1..81 98 -> Plus
2R 21025341..21025603 82..344 100 -> Plus
2R 21025661..21025755 345..439 100 -> Plus
2R 21025816..21026086 440..710 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:36 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16912585..16912665 1..81 98 -> Plus
arm_2R 16913166..16913260 345..439 100 -> Plus
arm_2R 16912846..16913108 82..344 100 -> Plus
arm_2R 16913321..16913591 440..710 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:11 Download gff for RH51452.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21026540..21026802 82..344 100 -> Plus
2R 21026860..21026954 345..439 100 -> Plus
2R 21027015..21027285 440..710 100   Plus
2R 21026279..21026359 1..81 98 -> Plus

RH51452.pep Sequence

Translation from 87 to 599

> RH51452.pep
MSLLRSKYYDHPDGEDAFGKIVATNKYAVSAGVAWSMFDVLTLSKPQGYL
PTLGRFAYNTGPLMGMATAFTLTTLVATNARGKDDKINYLIGGFAAGGVF
GAWKHNHVAGLCAGLFLGIAGVIKKMSIEQGWEFFPNTPIKQYGGLNIAG
NDWTIMADPPKNWTTEKPKE*

RH51452.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11926-PA 174 GF11926-PA 1..170 1..170 705 89.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22078-PA 170 GG22078-PA 1..170 1..170 795 94.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20525-PA 167 GH20525-PA 1..167 1..167 714 85.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B14.7-PA 170 CG9350-PA 1..170 1..170 917 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18971-PA 171 GI18971-PA 1..170 1..170 708 83.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10144-PA 169 GL10144-PA 1..167 1..167 791 87.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21720-PA 169 GA21720-PA 1..167 1..167 742 89.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15797-PA 170 GM15797-PA 1..170 1..170 806 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11557-PA 170 GD11557-PA 1..170 1..170 803 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21995-PA 168 GJ21995-PA 1..167 1..167 727 88.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23263-PA 171 GK23263-PA 1..170 1..170 717 84.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12159-PA 170 GE12159-PA 1..170 1..170 796 94.7 Plus

RH51452.hyp Sequence

Translation from 87 to 599

> RH51452.hyp
MSLLRSKYYDHPDGEDAFGKIVATNKYAVSAGVAWSMFDVLTLSKPQGYL
PTLGRFAYNTGPLMGMATAFTLTTLVATNARGKDDKINYLIGGFAAGGVF
GAWKHNHVAGLCAGLFLGIAGVIKKMSIEQGWEFFPNTPIKQYGGLNIAG
NDWTIMADPPKNWTTEKPKE*

RH51452.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9350-PA 170 CG9350-PA 1..170 1..170 917 100 Plus