Clone RH52122 Report

Search the DGRC for RH52122

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:521
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG1116-RB
Protein status:RH52122.pep: gold
Preliminary Size:2054
Sequenced Size:1573

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1116 2002-01-01 Sim4 clustering to Release 2
CG1116 2003-01-01 Sim4 clustering to Release 3
CG1116 2003-08-11 Blastp of sequenced clone
CG1116 2008-04-29 Release 5.5 accounting
CG1116 2008-08-15 Release 5.9 accounting
CG1116 2008-12-18 5.12 accounting

Clone Sequence Records

RH52122.complete Sequence

1573 bp (1573 high quality bases) assembled on 2003-08-11

GenBank Submission: BT010211

> RH52122.complete
GACTCTACGGGAGTCGCGACCAAATAAAAAAGTAAATAGATGATTGAAAT
TAAGGCGAAACTGCTGCGTGCGGACTCGGCCATCTACGCCACGGGCGAGA
GAGTCCAGTGCCTGATCGAGTTCACCCACAAGGTGTTCTCCGACGAGCCA
GCCGCGTCGCAGGCTGTCCACAATGCCAACGAAGTAAGCCAGGAGAACCT
GGCCTGGGCCTCGGCGCAGCTGCACTGCTACCGGAAAACTAGCTACTCTA
CATCCGCGGGCGACCGAGCCGCGGAGCTCACGGATGATCGGCAGGACGGC
TTTGGATGCGGTGACGCAGGCGCCGGGAGAGGTGATTGTGGCCACCAAGC
CCAAGATCCTCTTCTGCGACCTGCGCCTCCAGCCTGGAGAGACCAAGATG
TACTTTTTCAATGAATTCATTCCCCGCGATGGCCCACCCACGTACAGAGG
CCACAACATCCGGTACTTCTACAAGATCACCATTGCTACGCAACGGGTCA
AGTCCAAGGTGCAAACGCTGGCCGTTCCCATCCGGGTGTTGCCAATTCCC
ATAATTTCGCGGCCCGACGAACTTCCCGTAACCGTAGAGACCAACGAAGA
GCTGGCGCCCACTAATCCGTTCCTGGAAAAGCGCGAGATCAGCGAGCTTG
AGATATCGTGGCACCACCTTAAGAACGTAACCGCTCGGCGGGCGCCGAAG
TTCTACCGCATCTCGAACAAACGCGGCTTCGTTGGCCGCTTTTGTTTGTT
CAAGCCAGCGTATAAGCTCGGTGAGGACATTGTGGGCAGCCTGGACTTTG
ATCCCGGCGTTAACCCCCGAAAGGTGCGCTGCGTCCAGTTTTCGGTAAAG
CTGCAGCAGCAGGAGCTTTCCATCCGACCGCAACCAGTGCAAAATCACCA
GCTGCAGTCGCAATCCTCGACGGGCGATGATGTCTCCTCGATGAACTCCT
TTGATATGGCCAGCATAGCTAGCGGAGTGTTGGCAGATAACCTCCACAAG
TCGGCCACATCGGCTAGCTCAAAGGTTAAGGAGGCGCCTGAGCCAACCGG
GAAACTTTCGACCATTTCCACCTCCCACCAAGTGTGCTACGCAACGCTGC
AGACCCAGGTCGTGGTACCCATTCCGCTGCACGTAACACCAACATTCCGC
ACAGACCTCGTCGACGTGCGATGGCGATTGCATTTCGAGTTTGTGACCAC
AACTTTGATTGACTTTGGCATTCCGAATCCGGAGTCCGGCGAGCTAAAAG
CACCGTCTGAAATGCCCGTGGAGACGATGGTATGGAATCTGCCCGTGACC
GTCTACGCTGCGAATCCTCTCCAGATTTATGCTCCAAACCAGACATTCAA
CCTGCTTATAAAGTAATAGCACTTCAGTTAACTGTGTTCTCTTGATGGAA
GCTATATAAGGCCGTTTAGAAAGAGCAAACGAAAGCAACAAGTCGATTAC
GGTTCCTTTTAAAAACTTCTGAAACCCAATCCCCTCTTACGTCTTTGTAA
AATACAAAAATCTTAATTAAAATTTAGTCGAATATACGAATCAAACCGCT
TGAAATCAAAAAAAAAAAAAAAA

RH52122.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG1116-RA 1599 CG1116-RA 42..1599 2..1557 7690 99.6 Plus
CG1116.a 1602 CG1116.a 42..1602 2..1557 7635 99.4 Plus
CG1116-RB 1654 CG1116-RB 281..1654 186..1557 6800 99.7 Plus
CG1116-RB 1654 CG1116-RB 34..220 2..188 905 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1046411..1046990 822..1401 2885 99.8 Plus
chr3R 27901430 chr3R 1045863..1046134 402..673 1360 100 Plus
chr3R 27901430 chr3R 1045580..1045797 186..401 1025 99.1 Plus
chr3R 27901430 chr3R 1045333..1045519 2..188 905 98.9 Plus
chr3R 27901430 chr3R 1047056..1047212 1401..1557 785 100 Plus
chr3R 27901430 chr3R 1046198..1046351 672..825 770 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5220747..5221326 822..1401 2885 99.8 Plus
3R 32079331 3R 5220199..5220470 402..673 1360 100 Plus
3R 32079331 3R 5219916..5220133 186..401 1025 99.1 Plus
3R 32079331 3R 5219669..5219855 2..188 905 98.9 Plus
3R 32079331 3R 5221392..5221553 1401..1562 795 99.4 Plus
3R 32079331 3R 5220534..5220687 672..825 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4961578..4962157 822..1401 2885 99.8 Plus
3R 31820162 3R 4961030..4961301 402..673 1360 100 Plus
3R 31820162 3R 4960747..4960964 186..401 1035 99 Plus
3R 31820162 3R 4960500..4960686 2..188 905 98.9 Plus
3R 31820162 3R 4962223..4962384 1401..1562 795 99.3 Plus
3R 31820162 3R 4961365..4961518 672..825 770 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:39:42 has no hits.

RH52122.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:40:19 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1045332..1045519 1..188 98 -> Plus
chr3R 1045583..1045797 189..401 99 -> Plus
chr3R 1045863..1046134 402..673 100 -> Plus
chr3R 1046200..1046349 674..823 100 -> Plus
chr3R 1046413..1046989 824..1400 99 -> Plus
chr3R 1047056..1047212 1401..1557 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:14 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RC 1..1329 40..1366 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:20 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 1..1329 40..1366 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:35:39 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 1..1329 40..1366 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:16:59 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RC 1..1329 40..1366 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:52 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 1..1329 40..1366 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:11 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 2..1559 2..1557 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:20 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 2..1559 2..1557 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:35:39 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 12..1570 1..1557 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:17:00 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 2..1559 2..1557 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:52 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
CG1116-RA 12..1570 1..1557 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:19 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5219919..5220133 189..401 99 -> Plus
3R 5219668..5219855 1..188 98 -> Plus
3R 5220199..5220470 402..673 100 -> Plus
3R 5220536..5220685 674..823 100 -> Plus
3R 5220749..5221325 824..1400 99 -> Plus
3R 5221392..5221548 1401..1557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:19 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5219919..5220133 189..401 99 -> Plus
3R 5219668..5219855 1..188 98 -> Plus
3R 5220199..5220470 402..673 100 -> Plus
3R 5220536..5220685 674..823 100 -> Plus
3R 5220749..5221325 824..1400 99 -> Plus
3R 5221392..5221548 1401..1557 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:40:19 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5219919..5220133 189..401 99 -> Plus
3R 5219668..5219855 1..188 98 -> Plus
3R 5220199..5220470 402..673 100 -> Plus
3R 5220536..5220685 674..823 100 -> Plus
3R 5220749..5221325 824..1400 99 -> Plus
3R 5221392..5221548 1401..1557 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:35:39 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1046258..1046407 674..823 100 -> Plus
arm_3R 1045390..1045577 1..188 98 -> Plus
arm_3R 1045641..1045855 189..401 99 -> Plus
arm_3R 1045921..1046192 402..673 100 -> Plus
arm_3R 1046471..1047047 824..1400 99 -> Plus
arm_3R 1047114..1047270 1401..1557 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:51:02 Download gff for RH52122.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4960750..4960964 189..401 99 -> Plus
3R 4961030..4961301 402..673 100 -> Plus
3R 4961367..4961516 674..823 100 -> Plus
3R 4961580..4962156 824..1400 99 -> Plus
3R 4962223..4962379 1401..1557 100   Plus
3R 4960499..4960686 1..188 98 -> Plus

RH52122.hyp Sequence

Translation from 39 to 1365

> RH52122.hyp
MIEIKAKLLRADSAIYATGERVQCLIEFTHKVFSDEPAASQAVHNANEAS
QENLAWASAQLHCYRKTSYSTSAGDRAAELTEMIGRTALDAVTQAPGEVI
VATKPKILFCDLRLQPGETKMYFFNEFIPRDGPPTYRGHNIRYFYKITIA
TQRVKSKVQTLAVPIRVLPIPIISRPDELPVTVETNEELAPTNPFLEKRE
ISELEISWHHLKNVTARRAPKFYRISNKRGFVGRFCLFKPAYKLGEDIVG
SLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQPVQNHQLQSQSSTGDDVS
SMNSFDMASIASGVLADNLHKSATSASSKVKEAPEPTGKLSTISTSHQVC
YATLQTQVVVPIPLHVTPTFRTDLVDVRWRLHFEFVTTTLIDFGIPNPES
GELKAPSEMPVETMVWNLPVTVYAANPLQIYAPNQTFNLLIK*

RH52122.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG1116-PA 442 CG1116-PA 1..442 1..442 2284 100 Plus
CG1116-PD 443 CG1116-PD 1..443 1..442 2272 99.8 Plus
CG1116-PB 360 CG1116-PB 1..360 83..442 1869 100 Plus

RH52122.pep Sequence

Translation from 283 to 1365

> RH52122.pep
MIGRTALDAVTQAPGEVIVATKPKILFCDLRLQPGETKMYFFNEFIPRDG
PPTYRGHNIRYFYKITIATQRVKSKVQTLAVPIRVLPIPIISRPDELPVT
VETNEELAPTNPFLEKREISELEISWHHLKNVTARRAPKFYRISNKRGFV
GRFCLFKPAYKLGEDIVGSLDFDPGVNPRKVRCVQFSVKLQQQELSIRPQ
PVQNHQLQSQSSTGDDVSSMNSFDMASIASGVLADNLHKSATSASSKVKE
APEPTGKLSTISTSHQVCYATLQTQVVVPIPLHVTPTFRTDLVDVRWRLH
FEFVTTTLIDFGIPNPESGELKAPSEMPVETMVWNLPVTVYAANPLQIYA
PNQTFNLLIK*

RH52122.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18927-PA 439 GF18927-PA 84..439 1..360 1715 91.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12649-PA 441 GG12649-PA 83..441 1..360 1841 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:51:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17709-PA 422 GH17709-PA 72..422 1..360 1622 83.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG1116-PD 443 CG1116-PD 84..443 1..360 1869 100 Plus
CG1116-PA 442 CG1116-PA 83..442 1..360 1869 100 Plus
CG1116-PB 360 CG1116-PB 1..360 1..360 1869 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22539-PA 428 GI22539-PA 78..428 1..360 1657 84.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21632-PA 435 GL21632-PA 81..435 1..360 1686 86.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10805-PA 434 GA10805-PA 81..434 1..360 1677 86.9 Plus
Dpse\GA10805-PB 399 GA10805-PB 46..399 1..360 1676 86.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10792-PA 442 GM10792-PA 83..442 1..360 1906 97.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19766-PA 360 GD19766-PA 1..360 1..360 1892 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10143-PA 432 GJ10143-PA 82..432 1..360 1658 85.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12960-PA 433 GK12960-PA 82..433 1..360 1629 83.7 Plus
Dwil\GK13223-PA 53 GK13223-PA 1..53 308..360 240 83 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:51:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25453-PA 441 GE25453-PA 82..441 1..360 1813 93.9 Plus