Clone RH52355 Report

Search the DGRC for RH52355

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:523
Well:55
Vector:pFlc-1
Associated Gene/TranscriptCG4250-RA
Protein status:RH52355.pep: gold
Preliminary Size:634
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4250 2002-01-01 Sim4 clustering to Release 2
CG4250 2002-04-22 Blastp of sequenced clone
CG4250 2003-01-01 Sim4 clustering to Release 3
CG4250 2008-04-29 Release 5.5 accounting
CG4250 2008-08-15 Release 5.9 accounting
CG4250 2008-12-18 5.12 accounting

Clone Sequence Records

RH52355.complete Sequence

633 bp (633 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113600

> RH52355.complete
GTGAGTCGCTGTCGGCAATTCAAACGCGTAGCACACATCGGTCGGAATAA
TTAGAATGGAGAAGAACTTTCAATACGAGAATATGCAGCCTCAGGCTCCG
GGTTTCCAGGCACCGCCCAGTTATGATAGCGCACCGCAGCAGGTCTATCC
TCAGCTCCATCAGGGACAGGGAGTGATATTGCAGGCTCCACCCAATGTCC
TGGGCCAATGTCCATCCGTTGCCACTTGTCCGAGCTGCGGCGTCCGCAGG
GAGACGAAGGTGGAGTTCGAGCCCAGCACCAAGACCCACCTGTTGGCCCT
ACTCATCTGCATGCTGGGGGGCATTTGCTGCTGCTGCATTCCGTACTGCA
CCGACTCCTGCCAGTCGGCCAAACACACCTGCACCAGCTGTGGAGCCTAC
GTGGGCACCTACAAGAACTAGAAGTGCTATCTCAACACCAAATATTACAG
GGATAGATCCCACGTTGTATCTCCACACCTATTGATGGGATCAGATTTGG
CACGAATATTCACGAAATACAACTCTGGTTCAAATCAATTGAATATATGT
ATGTAATTTTCGCATTGGTTTACTTTTCAAAATAAATTTCTAATCACACA
AATTGTTGGCGATATATGAAAAAAAAAAAAAAA

RH52355.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG4250-RA 826 CG4250-RA 151..767 4..620 3070 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18550706..18551006 318..618 1460 99 Plus
chr2R 21145070 chr2R 18550225..18550406 4..185 895 99.5 Plus
chr2R 21145070 chr2R 18550520..18550654 185..319 675 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22664174..22664476 318..620 1500 99.7 Plus
2R 25286936 2R 22663693..22663874 4..185 910 100 Plus
2R 25286936 2R 22663988..22664122 185..319 675 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22665373..22665675 318..620 1500 99.6 Plus
2R 25260384 2R 22664892..22665073 4..185 910 100 Plus
2R 25260384 2R 22665187..22665321 185..319 675 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:55:15 has no hits.

RH52355.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:56 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18550707..18551006 319..618 99   Plus
chr2R 18550222..18550406 1..185 98 -> Plus
chr2R 18550521..18550653 186..318 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:17 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:50 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:36 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:51:10 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:08 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 1..366 56..421 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:37:52 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 3..620 1..618 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:50 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 3..620 1..618 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:36 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 2..616 4..618 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:51:10 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 3..620 1..618 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:08 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
CG4250-RA 2..616 4..618 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:56 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22663690..22663874 1..185 98 -> Plus
2R 22663989..22664121 186..318 100 -> Plus
2R 22664175..22664474 319..618 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:56 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22663690..22663874 1..185 98 -> Plus
2R 22663989..22664121 186..318 100 -> Plus
2R 22664175..22664474 319..618 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:56 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22663690..22663874 1..185 98 -> Plus
2R 22663989..22664121 186..318 100 -> Plus
2R 22664175..22664474 319..618 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:36 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18551494..18551626 186..318 100 -> Plus
arm_2R 18551195..18551379 1..185 98 -> Plus
arm_2R 18551680..18551979 319..618 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:23:07 Download gff for RH52355.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22665374..22665673 319..618 99   Plus
2R 22664889..22665073 1..185 98 -> Plus
2R 22665188..22665320 186..318 100 -> Plus

RH52355.hyp Sequence

Translation from 55 to 420

> RH52355.hyp
MEKNFQYENMQPQAPGFQAPPSYDSAPQQVYPQLHQGQGVILQAPPNVLG
QCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGICCCCIPYCTD
SCQSAKHTCTSCGAYVGTYKN*

RH52355.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG4250-PA 121 CG4250-PA 1..121 1..121 681 100 Plus
CG4250-PB 134 CG4250-PB 1..134 1..121 657 90.3 Plus
CG30273-PB 128 CG30273-PB 2..127 6..121 238 38.1 Plus
CG30269-PB 144 CG30269-PB 32..141 19..119 218 37.3 Plus
CG30269-PA 144 CG30269-PA 32..141 19..119 218 37.3 Plus

RH52355.pep Sequence

Translation from 55 to 420

> RH52355.pep
MEKNFQYENMQPQAPGFQAPPSYDSAPQQVYPQLHQGQGVILQAPPNVLG
QCPSVATCPSCGVRRETKVEFEPSTKTHLLALLICMLGGICCCCIPYCTD
SCQSAKHTCTSCGAYVGTYKN*

RH52355.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11635-PA 127 GF11635-PA 44..126 40..121 193 47.1 Plus
Dana\GF11636-PA 142 GF11636-PA 33..141 19..121 177 35.8 Plus
Dana\GF11281-PA 129 GF11281-PA 57..129 49..121 176 46.6 Plus
Dana\GF11638-PA 164 GF11638-PA 36..159 17..120 172 34.7 Plus
Dana\GF24273-PA 125 GF24273-PA 4..125 15..121 132 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21064-PA 113 GG21064-PA 1..113 1..121 467 79.3 Plus
Dere\GG22779-PA 128 GG22779-PA 1..127 5..121 194 37 Plus
Dere\GG22780-PA 150 GG22780-PA 66..149 38..121 177 39.3 Plus
Dere\GG21061-PA 129 GG21061-PA 57..129 49..121 176 46.6 Plus
Dere\GG22782-PA 168 GG22782-PA 90..162 49..120 155 37 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19766-PA 130 GH19766-PA 58..130 49..121 271 68.5 Plus
Dgri\GH19768-PA 137 GH19768-PA 16..136 3..121 218 39.8 Plus
Dgri\GH19767-PA 124 GH19767-PA 7..124 18..121 196 50.8 Plus
Dgri\GH19762-PA 102 GH19762-PA 30..102 49..121 182 46.6 Plus
Dgri\GH19769-PA 142 GH19769-PA 34..139 19..119 180 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG4250-PA 121 CG4250-PA 1..121 1..121 681 100 Plus
CG4250-PB 134 CG4250-PB 1..134 1..121 657 90.3 Plus
CG30273-PB 128 CG30273-PB 2..127 6..121 238 38.1 Plus
CG30269-PB 144 CG30269-PB 32..141 19..119 218 37.3 Plus
CG30269-PA 144 CG30269-PA 32..141 19..119 218 37.3 Plus
CG13510-PC 129 CG13510-PC 19..129 8..121 210 39 Plus
CG13510-PB 129 CG13510-PB 19..129 8..121 210 39 Plus
CG13510-PA 129 CG13510-PA 19..129 8..121 210 39 Plus
CG13516-PB 168 CG13516-PB 39..161 18..119 184 30.1 Plus
CG13516-PA 168 CG13516-PA 39..161 18..119 184 30.1 Plus
CG42566-PA 77 CG42566-PA 5..76 49..120 179 43.1 Plus
CG42566-PB 77 CG42566-PB 5..76 49..120 179 43.1 Plus
CG12645-PC 202 CG12645-PC 113..189 44..119 154 33.8 Plus
CG12645-PB 206 CG12645-PB 117..193 44..119 154 33.8 Plus
CG13511-PB 122 CG13511-PB 24..120 21..119 153 34 Plus
CG13511-PA 122 CG13511-PA 24..120 21..119 153 34 Plus
CG32280-PD 130 CG32280-PD 15..129 15..120 147 32.2 Plus
CG32280-PC 130 CG32280-PC 15..129 15..120 147 32.2 Plus
CG32280-PB 130 CG32280-PB 15..129 15..120 147 32.2 Plus
CG32280-PA 130 CG32280-PA 15..129 15..120 147 32.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20305-PA 122 GI20305-PA 6..122 9..121 302 52.9 Plus
Dmoj\GI20307-PA 126 GI20307-PA 12..125 1..121 208 39.7 Plus
Dmoj\GI20299-PA 103 GI20299-PA 31..102 49..120 182 48.6 Plus
Dmoj\GI15068-PA 221 GI15068-PA 122..216 27..120 181 40 Plus
Dmoj\GI20300-PA 165 GI20300-PA 60..162 23..118 176 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11365-PA 112 GL11365-PA 12..112 23..121 319 62.4 Plus
Dper\GL11366-PA 129 GL11366-PA 1..128 5..121 190 38.3 Plus
Dper\GL11367-PA 143 GL11367-PA 30..142 19..121 174 33.9 Plus
Dper\GL11361-PA 129 GL11361-PA 57..129 49..121 171 43.8 Plus
Dper\GL11368-PA 167 GL11368-PA 29..162 8..120 170 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18059-PA 111 GA18059-PA 7..111 19..121 320 63 Plus
Dpse\GA15742-PA 129 GA15742-PA 1..128 5..121 190 38.3 Plus
Dpse\GA15738-PA 143 GA15738-PA 30..142 19..121 174 33.9 Plus
Dpse\GA12335-PA 129 GA12335-PA 57..129 49..121 171 43.8 Plus
Dpse\GA24699-PA 167 GA24699-PA 29..162 8..120 170 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15935-PA 100 GM15935-PA 1..99 1..120 365 64.2 Plus
Dsec\GM15936-PA 156 GM15936-PA 26..155 2..121 205 36.2 Plus
Dsec\GM15937-PA 144 GM15937-PA 32..143 19..121 185 36.6 Plus
Dsec\GM15931-PA 129 GM15931-PA 57..129 49..121 177 46.6 Plus
Dsec\GM15939-PA 168 GM15939-PA 90..162 49..120 156 37 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11688-PA 121 GD11688-PA 1..121 1..121 591 90.9 Plus
Dsim\GD11689-PA 128 GD11689-PA 1..127 5..121 203 37.8 Plus
Dsim\GD11691-PA 144 GD11691-PA 32..143 19..121 186 36.6 Plus
Dsim\GD11684-PA 129 GD11684-PA 57..129 49..121 177 46.6 Plus
Dsim\GD11692-PA 168 GD11692-PA 90..162 49..120 155 37 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22030-PA 99 GJ22030-PA 25..99 47..121 299 74.7 Plus
Dvir\GJ22033-PA 113 GJ22033-PA 2..112 4..121 207 39.5 Plus
Dvir\GJ22026-PA 137 GJ22026-PA 65..137 49..121 188 47.9 Plus
Dvir\GJ22032-PA 118 GJ22032-PA 43..118 46..121 184 63.2 Plus
Dvir\GJ22034-PA 147 GJ22034-PA 63..144 38..119 177 39 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21443-PA 150 GK21443-PA 76..150 47..121 262 61.3 Plus
Dwil\GK21444-PA 121 GK21444-PA 16..119 18..120 201 43.8 Plus
Dwil\GK21440-PA 130 GK21440-PA 37..130 32..121 177 40.4 Plus
Dwil\GK21445-PA 148 GK21445-PA 79..145 53..119 161 40.3 Plus
Dwil\GK21446-PA 161 GK21446-PA 93..156 58..120 154 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14007-PA 115 GE14007-PA 1..115 1..121 490 81 Plus
Dyak\GE14008-PA 128 GE14008-PA 1..127 5..121 201 37 Plus
Dyak\GE14009-PA 148 GE14009-PA 32..147 19..121 184 35.3 Plus
Dyak\GE14003-PA 128 GE14003-PA 56..128 49..121 176 46.6 Plus
Dyak\GE14011-PA 168 GE14011-PA 90..162 49..120 156 37 Plus