Clone RH52364 Report

Search the DGRC for RH52364

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:523
Well:64
Vector:pFlc-1
Associated Gene/TranscriptScp2-RA
Protein status:RH52364.pep: gold
Preliminary Size:1267
Sequenced Size:1301

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14904 2002-01-01 Sim4 clustering to Release 2
CG14904 2002-02-26 Blastp of sequenced clone
CG14904 2003-01-01 Sim4 clustering to Release 3
Scp2 2008-04-29 Release 5.5 accounting
Scp2 2008-08-15 Release 5.9 accounting
Scp2 2008-12-18 5.12 accounting

Clone Sequence Records

RH52364.complete Sequence

1301 bp (1301 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089680

> RH52364.complete
GATCATCACAAGACGGCCAACCGCGCTGCCGAGCAGACGAGTCCAGTTCG
AGAGGGTACCAAAATTTAATCAGAAAGTGTAGAGTCAGTTTAGAAGCAAC
GTTCCCCATTTCCGGTTGCAACTGTGGTGAGCCAATATAAGCTCAATAAA
GAAAACAACCAGCGGTAAATCAAACACACAAAAAAAAAACCAACACAATA
ATGTCGATCTCCGATTTCCGCAAAAAGAAGCTGCTTTTTCTGTTCAATGT
GTTCTTTGATGTGAACCAAAGCGGCGAAATCGACGTTAAGGACTTCGAGC
TGGCCATCGAGCGCGTTTGCCAACTGCGCGGCTGGCAGAAGGACACGCCG
AAGAACAAGGAGACCTACGACCTGATGATGGAAATCTGGACTGGCCTGCG
CTCCAAGGCCGACAAGGACAACGATGGACAGGTCAGCGTGGACGAGTGGT
GCAACATGTGGGACGCCTATGCCAAGGATCCCAGCAGCGTGATGGACTGG
CAGAATGCCTACATGAACTTCATGTTCGACCTGGAGGATGCCTCGCACGA
TGGAGGCATCGATGTGACCGAATTCACGCTGGTCTGCTCCAGCTATGGCC
TGGAGAAGACCGAGTGTGAGGAAGCCTTTGCGAAGATGTCTCAGGGGCAG
AGCGAGGTCACCCGGGAGCAGTTCGCCGCCTTGTGGAAGGAGTACTTCGC
CGCCGAGGATGTGAATGCGCCTGGCAACTACATTTTTGGAAAGACCAGTT
TCTAAGACCCAGCCAAATAAGAACAGCTCCGATACTGGACATACTGAACA
AATGCAACAAGTGAAATTATTATTAAAATTAATATTATATATCTATTGTC
GACAGGGGAGGCAGATCTCAACCCTCCCGACTTGATGATCCGTCGTTGTT
AGTTGAGTGTTGTTTTCTCTCCAAGAATCTCAAATTTTGCCCAATTCAAT
GTTCTAATTTAGTAGCGTAATCTGTCTGCAAACTATTTATATTTTATATA
CCAAGGCTTCGAGTAATGTGCAAGCTGTAGTATCTCTACACAAACACATA
TATGCAAAAGTGTACCTTTACGAACTACGACTATATCTAGCGATGATATC
AATTACGAGGTAGGATCTCCCACAGATCCGTATCAATGTGGTGCGTAAAT
TAAATCAATTAAACTGTCAAATTGTTATGTGTGTGTAGTCGTCGTTTATC
GTCTCGCATCTATGGCGTATAAATTTAAATGTAAATGTAAAGTGTTCCAA
GAAATTACAATAATAAAATCAAAGTATCTATACAAGAAAAAAAAAAAAAA
A

RH52364.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:24:20
Subject Length Description Subject Range Query Range Score Percent Strand
Scp2-RA 1326 Scp2-RA 34..1316 4..1285 6375 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12399076..12399932 1285..429 4255 99.8 Minus
chr3R 27901430 chr3R 12403525..12403683 258..101 745 99.4 Minus
chr3R 27901430 chr3R 12401456..12401579 433..310 620 100 Minus
chr3R 27901430 chr3R 12408101..12408198 101..4 490 100 Minus
chr3R 27901430 chr3R 12401856..12401909 311..258 270 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:32:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16574541..16575397 1285..429 4285 100 Minus
3R 32079331 3R 16578990..16579148 258..101 745 99.4 Minus
3R 32079331 3R 16576921..16577044 433..310 620 100 Minus
3R 32079331 3R 16583564..16583661 101..4 490 100 Minus
3R 32079331 3R 16577321..16577374 311..258 270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16315372..16316228 1285..429 4285 100 Minus
3R 31820162 3R 16319821..16319979 258..101 755 99.3 Minus
3R 31820162 3R 16317752..16317875 433..310 620 100 Minus
3R 31820162 3R 16324395..16324492 101..4 490 100 Minus
3R 31820162 3R 16318152..16318205 311..258 270 100 Minus
Blast to na_te.dros performed 2019-03-15 14:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT2 2775 Dbuz\BuT2 BUT2 2775bp 289..351 1218..1282 112 67.7 Plus

RH52364.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:36:06 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12399075..12399929 432..1286 99 <- Minus
chr3R 12401458..12401577 312..431 100 <- Minus
chr3R 12401856..12401908 259..311 100 <- Minus
chr3R 12403525..12403682 102..258 99 <- Minus
chr3R 12408101..12408201 1..101 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:18 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..555 201..755 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:35:43 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..555 201..755 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:32 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..555 201..755 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:07:17 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..555 201..755 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:08 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..555 201..755 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:01:15 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..1282 5..1286 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:35:43 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..1280 5..1283 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:32 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..1283 2..1283 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:07:18 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..1282 5..1286 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:08 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
Scp2-RA 1..1283 2..1283 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:06 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16574540..16575394 432..1286 99 <- Minus
3R 16576923..16577042 312..431 100 <- Minus
3R 16577321..16577373 259..311 100 <- Minus
3R 16578990..16579147 102..258 99 <- Minus
3R 16583564..16583664 1..101 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:06 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16574540..16575394 432..1286 99 <- Minus
3R 16576923..16577042 312..431 100 <- Minus
3R 16577321..16577373 259..311 100 <- Minus
3R 16578990..16579147 102..258 99 <- Minus
3R 16583564..16583664 1..101 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:06 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16574540..16575394 432..1286 99 <- Minus
3R 16576923..16577042 312..431 100 <- Minus
3R 16577321..16577373 259..311 100 <- Minus
3R 16578990..16579147 102..258 99 <- Minus
3R 16583564..16583664 1..101 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:32 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12403043..12403095 259..311 100 <- Minus
arm_3R 12404712..12404869 102..258 99 <- Minus
arm_3R 12409286..12409386 1..101 99   Minus
arm_3R 12400262..12401116 432..1286 99 <- Minus
arm_3R 12402645..12402764 312..431 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:41:14 Download gff for RH52364.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16315371..16316225 432..1286 99 <- Minus
3R 16317754..16317873 312..431 100 <- Minus
3R 16318152..16318204 259..311 100 <- Minus
3R 16319821..16319978 102..258 99 <- Minus
3R 16324395..16324495 1..101 99   Minus

RH52364.pep Sequence

Translation from 200 to 754

> RH52364.pep
MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTP
KNKETYDLMMEIWTGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDW
QNAYMNFMFDLEDASHDGGIDVTEFTLVCSSYGLEKTECEEAFAKMSQGQ
SEVTREQFAALWKEYFAAEDVNAPGNYIFGKTSF*

RH52364.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17935-PA 184 GF17935-PA 1..184 1..184 935 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16823-PA 184 GG16823-PA 1..184 1..184 974 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20505-PA 184 GH20505-PA 1..184 1..184 921 92.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Scp2-PA 184 CG14904-PA 1..184 1..184 990 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10386-PA 184 GI10386-PA 1..184 1..184 943 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27293-PA 184 GL27293-PA 1..184 1..184 948 95.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13342-PA 184 GA13342-PA 1..184 1..184 948 95.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15421-PA 184 GM15421-PA 1..184 1..184 974 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:32:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20278-PA 184 GD20278-PA 1..184 1..184 974 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22847-PA 184 GJ22847-PA 1..184 1..184 932 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:32:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22835-PA 185 GK22835-PA 1..184 1..184 931 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:32:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26142-PA 184 GE26142-PA 1..184 1..184 974 98.9 Plus

RH52364.hyp Sequence

Translation from 200 to 754

> RH52364.hyp
MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTP
KNKETYDLMMEIWTGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDW
QNAYMNFMFDLEDASHDGGIDVTEFTLVCSSYGLEKTECEEAFAKMSQGQ
SEVTREQFAALWKEYFAAEDVNAPGNYIFGKTSF*

RH52364.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Scp2-PA 184 CG14904-PA 1..184 1..184 990 100 Plus