Clone RH54371 Report

Search the DGRC for RH54371

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:543
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG8343-RA
Protein status:RH54371.pep: gold
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8343 2003-01-01 Sim4 clustering to Release 3
CG8343 2004-01-31 Blastp of sequenced clone
CG8343 2008-04-29 Release 5.5 accounting
CG8343 2008-08-15 Release 5.9 accounting
CG8343 2008-12-18 5.12 accounting

Clone Sequence Records

RH54371.complete Sequence

648 bp (648 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011519

> RH54371.complete
GATACAAATCAACATGCGTTCCCTATTCCTGGTCTGTTTGGTCTTCTGCT
CCGCTTGGTCCTTGCCAGAATCGGACCTCTTACCCACATCTCCAGCACCC
GGAAACGACACCGCCGAGGAGCCTCAGCTGCCCGCCTTCTCGCCATTTAG
TCTGCGCGATGGCAGGTTCGCCATAGGTGCCTTTGCCAAAGTGAACTGGT
TCCAAGCTCAGGCCACCTGTGCCGCCTATGGGTACACGCTCGTAAGCATT
ACATCCGAGCAGGATCAGCGCAGTCTCCGCAACTTCCTCTTCAACTACGC
CCGGAACCAGCAGGATCTGCTGACCGATCCGCTCTGGACCTCGGGCACCG
ACCTGGCCAGTGACAACAACTGGGTGTGGTTCAGCAAGGGGCGCGCCGTC
AACTACCGCAACTTCCAGAACGGTCTACCGGGCTACTCCAGCGATAATCG
CCACTGCCTTGGCATCAATGGAATTAACGGACTATGGGTGAACGAGAACT
GCTCAGAGCTGCGCTACTTCGTTTGCGAGAAGCGTTGCCAGTTCGATGAC
GACGTAAACTAACCTAATTTGACGAAGTGAGTCGAAAAAGAGTCCGGTTG
TTAAATAAAATATCAGCCGAATATGTGCAATTAAAAAAAAAAAAAAAA

RH54371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8343-RA 651 CG8343-RA 7..642 2..637 3180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2066791..2067421 2..632 3140 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6179726..6180361 2..637 3180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6180925..6181560 2..637 3180 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:37:16 has no hits.

RH54371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:30 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2066790..2067421 1..632 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:42 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..549 14..562 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:20 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..549 14..562 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:01:28 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..549 14..562 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:14 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..549 14..562 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:32 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..549 14..562 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:18 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 6..637 1..632 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:20 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 6..637 1..632 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:01:28 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..631 2..632 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:14 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 6..637 1..632 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:32 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
CG8343-RA 1..631 2..632 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:30 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6179725..6180356 1..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:30 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6179725..6180356 1..632 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:30 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6179725..6180356 1..632 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:01:28 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2067230..2067861 1..632 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:34 Download gff for RH54371.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6180924..6181555 1..632 99   Plus

RH54371.hyp Sequence

Translation from 0 to 561

> RH54371.hyp
IQINMRSLFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFS
LRDGRFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYA
RNQQDLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNR
HCLGINGINGLWVNENCSELRYFVCEKRCQFDDDVN*

RH54371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG8343-PA 182 CG8343-PA 1..182 5..186 997 100 Plus
CG9134-PC 188 CG9134-PC 12..184 7..176 187 27.9 Plus
CG9134-PA 188 CG9134-PA 12..184 7..176 187 27.9 Plus
CG9134-PB 376 CG9134-PB 245..372 51..176 184 30.8 Plus
CG11211-PA 176 CG11211-PA 42..166 56..182 152 25 Plus

RH54371.pep Sequence

Translation from 13 to 561

> RH54371.pep
MRSLFLVCLVFCSAWSLPESDLLPTSPAPGNDTAEEPQLPAFSPFSLRDG
RFAIGAFAKVNWFQAQATCAAYGYTLVSITSEQDQRSLRNFLFNYARNQQ
DLLTDPLWTSGTDLASDNNWVWFSKGRAVNYRNFQNGLPGYSSDNRHCLG
INGINGLWVNENCSELRYFVCEKRCQFDDDVN*

RH54371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11047-PA 186 GF11047-PA 18..186 16..182 645 71.6 Plus
Dana\GF24446-PA 386 GF24446-PA 253..382 45..172 175 30.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23197-PA 182 GG23197-PA 1..182 1..182 911 92.9 Plus
Dere\GG14773-PA 376 GG14773-PA 243..372 45..172 179 31.1 Plus
Dere\GG19039-PA 188 GG19039-PA 7..174 7..172 140 27.2 Plus
Dere\GG10829-PA 176 GG10829-PA 39..167 49..179 138 22.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20936-PA 180 GH20936-PA 1..175 1..175 263 36.3 Plus
Dgri\GH20946-PA 127 GH20946-PA 1..115 60..175 218 36.9 Plus
Dgri\GH15445-PA 407 GH15445-PA 274..403 45..172 182 31.1 Plus
Dgri\GH24460-PA 195 GH24460-PA 10..181 4..172 166 29.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8343-PA 182 CG8343-PA 1..182 1..182 997 100 Plus
tfc-PC 188 CG9134-PC 12..184 3..172 187 27.9 Plus
tfc-PA 188 CG9134-PA 12..184 3..172 187 27.9 Plus
tfc-PB 376 CG9134-PB 245..372 47..172 184 30.8 Plus
CG11211-PA 176 CG11211-PA 42..166 52..178 152 25 Plus
lectin-46Cb-PB 322 CG1652-PB 46..164 59..179 146 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18372-PA 172 GI18372-PA 1..169 1..176 292 40 Plus
Dmoj\GI13046-PA 379 GI13046-PA 246..375 45..172 183 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16248-PA 171 GL16248-PA 1..169 1..179 567 59.2 Plus
Dper\GL16247-PA 171 GL16247-PA 1..169 1..179 561 59.2 Plus
Dper\GL16169-PA 214 GL16169-PA 61..150 45..139 157 32.6 Plus
Dper\GL16256-PA 172 GL16256-PA 29..163 43..179 139 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21005-PA 171 GA21005-PA 1..169 1..179 565 58.7 Plus
Dpse\GA25106-PA 171 GA25106-PA 1..169 1..179 564 59.2 Plus
Dpse\GA21567-PA 381 GA21567-PA 248..377 45..172 181 31.1 Plus
Dpse\GA24335-PB 590 GA24335-PB 1..167 1..173 142 27.1 Plus
Dpse\GA10845-PA 172 GA10845-PA 29..163 43..179 140 26.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16537-PA 182 GM16537-PA 1..182 1..182 926 95.6 Plus
Dsec\GM14393-PA 375 GM14393-PA 242..371 45..172 178 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10399-PA 182 GD10399-PA 1..182 1..182 923 95.1 Plus
Dsim\GD13601-PA 375 GD13601-PA 242..371 45..172 178 31.1 Plus
Dsim\GD10332-PA 176 GD10332-PA 34..166 44..178 140 23.5 Plus
Dsim\GD24567-PA 188 GD24567-PA 46..174 43..172 136 27.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21448-PA 162 GJ21448-PA 37..162 44..175 296 42.4 Plus
Dvir\GJ21449-PA 169 GJ21449-PA 31..169 35..176 262 38.5 Plus
Dvir\GJ12142-PA 412 GJ12142-PA 279..408 45..172 181 31.1 Plus
Dvir\GJ20885-PA 154 GJ20885-PA 22..143 51..175 160 27 Plus
Dvir\GJ19459-PA 194 GJ19459-PA 52..180 43..172 148 30.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21333-PA 178 GK21333-PA 1..175 1..180 472 52.8 Plus
Dwil\GK21332-PA 173 GK21332-PA 1..171 1..181 441 48.1 Plus
Dwil\GK21163-PA 190 GK21163-PA 57..186 45..172 178 31.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20736-PA 182 GE20736-PA 1..182 1..182 911 93.4 Plus
Dyak\GE21136-PA 379 GE21136-PA 246..375 45..172 178 31.1 Plus
Dyak\GE19424-PA 176 GE19424-PA 1..166 4..178 153 24.3 Plus
Dyak\GE17444-PA 188 GE17444-PA 7..174 7..172 141 27.2 Plus