Clone RH54514 Report

Search the DGRC for RH54514

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:545
Well:14
Vector:pFlc-1
Associated Gene/TranscriptAdh-RC
Protein status:RH54514.pep: gold
Sequenced Size:1247

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32954 2004-03-31 Blastp of sequenced clone
Adh 2008-04-29 Release 5.5 accounting
Adh 2008-08-15 Release 5.9 accounting
Adhr 2008-08-15 Release 5.9 accounting
Adh 2008-12-18 5.12 accounting
Adhr 2008-12-18 5.12 accounting

Clone Sequence Records

RH54514.complete Sequence

1247 bp (1247 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012435

> RH54514.complete
GATTATTGTCTCAGTGCAGTTGTCAGTTGCAGTTCAGCAGACGGGCTAAC
GAGTACTTGCATCTCTTCAAATTTACTTAATTGATCAAGCAGCGCTGCCG
TCGCCGGCTGAGCAGCCTGCGTACATAGCCGAGATCGCGTAACGGTAGAT
AATGAAAAGCTCTACGTAACCGAAGCTTCTGCTGTACGGATCTTCCTATA
AATACGGGGCCGACACGAACTGGAAACCAACAACTAACGGAGCCCTCTTC
CAATTGAAACAGATCGAAAGAGCCTGCTAAAGCAAAAAAGAAGTCACCAT
GTCGTTTACTTTGACCAACAAGAACGTGATTTTCGTTGCCGGTCTGGGAG
GCATTGGTCTGGACACCAGCAAGGAGCTGCTCAAGCGCGATCTGAAGAAC
CTGGTGATCCTCGACCGCATTGAGAACCCGGCTGCCATTGCCGAGCTGAA
GGCAATCAATCCAAAGGTGACCGTCACCTTCTACCCCTATGATGTGACCG
TGCCCATTGCCGAGACCACCAAGCTGCTGAAGACCATCTTCGCCCAGCTG
AAGACCGTCGATGTCCTGATCAACGGAGCTGGTATCCTGGACGATCACCA
GATCGAGCGCACCATTGCCGTCAACTACACTGGCCTGGTCAACACCACGA
CGGCCATTCTGGACTTCTGGGACAAGCGCAAGGGCGGTCCCGGTGGTATC
ATCTGCAACATTGGATCCGTCACTGGATTCAATGCCATCTACCAGGTGCC
CGTCTACTCCGGCACCAAGGCCGCCGTGGTCAACTTCACCAGCTCCCTGG
CGAAACTGGCCCCCATTACCGGCGTGACGGCTTACACTGTGAACCCCGGC
ATCACCCGCACCACCCTGGTGCACACGTTCAACTCCTGGTTGGATGTTGA
GCCTCAGGTTGCCGAGAAGCTCCTGGCTCATCCCACCCAGCCCTCGTTGG
CCTGCGCCGAGAACTTCGTCAAGGCTATCGAGCTGAACCAGAACGGAGCC
ATCTGGAAACTGGACTTGGGCACCCTGGAGGCCATCCAGTGGACCAAGCA
CTGGGACTCCGGCATCTAAGAAGTGATACTCCCAAAAAAAAAAAAAAAAC
ATAACATTAGTTCATAGGGTTCTGCGAACCAGAAGATATTCACGCAAGGC
AATAAGGCTGATTCGATGCACACTCACATTCTTCTCCTAATACGATAATA
AAACTTTCCATGAAAAATATGGAAAAATAAAGAAAAAAAAAAAAAAA

RH54514.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
Adh-RI 1245 Adh-RI 3..1229 2..1229 6100 99.9 Plus
Adh-RC 1071 Adh-RC 90..1055 263..1229 4795 99.8 Plus
Adhr-RA 2077 Adhr-RA 90..1055 263..1229 4795 99.8 Plus
Adh-RC 1071 Adh-RC 3..89 2..88 435 100 Plus
Adhr-RA 2077 Adhr-RA 3..89 2..88 435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14615639..14616065 802..1229 2090 99.8 Plus
chr2L 23010047 chr2L 14615163..14615569 396..802 2035 100 Plus
chr2L 23010047 chr2L 14614791..14615099 89..397 1545 100 Plus
chr2L 23010047 chr2L 14614219..14614306 2..89 440 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14616977..14617403 802..1229 2090 99.8 Plus
2L 23513712 2L 14616501..14616907 396..802 2035 100 Plus
2L 23513712 2L 14616129..14616437 89..397 1545 100 Plus
2L 23513712 2L 14615557..14615644 2..89 440 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14616977..14617403 802..1229 2100 99.7 Plus
2L 23513712 2L 14616501..14616907 396..802 2035 100 Plus
2L 23513712 2L 14616129..14616437 89..397 1545 100 Plus
2L 23513712 2L 14615557..14615644 2..89 440 100 Plus
Blast to na_te.dros performed 2019-03-16 14:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy7 5486 gypsy7 GYPSY7 5486bp 1687..1719 277..309 111 81.8 Plus

RH54514.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:38:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14614217..14614305 1..88 98 -> Plus
chr2L 14614791..14615099 89..397 100 -> Plus
chr2L 14615165..14615569 398..802 100 -> Plus
chr2L 14615640..14616067 803..1232 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RH 1..771 299..1069 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:11 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RH 1..771 299..1069 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:02:03 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RH 1..771 299..1069 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:00 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RH 1..771 299..1069 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:42 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RH 1..771 299..1069 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:44:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RI 1..1231 1..1232 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:11 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RI 1..1231 1..1232 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:02:03 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RI 4..1234 1..1232 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:00 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RI 1..1231 1..1232 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:42 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
Adh-RI 4..1231 1..1228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14615555..14615643 1..88 98 -> Plus
2L 14616129..14616437 89..397 100 -> Plus
2L 14616503..14616907 398..802 100 -> Plus
2L 14616978..14617405 803..1232 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14615555..14615643 1..88 98 -> Plus
2L 14616129..14616437 89..397 100 -> Plus
2L 14616503..14616907 398..802 100 -> Plus
2L 14616978..14617405 803..1232 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:44 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14615555..14615643 1..88 98 -> Plus
2L 14616129..14616437 89..397 100 -> Plus
2L 14616503..14616907 398..802 100 -> Plus
2L 14616978..14617405 803..1232 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:02:03 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14615555..14615643 1..88 98 -> Plus
arm_2L 14616129..14616437 89..397 100 -> Plus
arm_2L 14616503..14616907 398..802 100 -> Plus
arm_2L 14616978..14617405 803..1232 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:58:22 Download gff for RH54514.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14616129..14616437 89..397 100 -> Plus
2L 14616503..14616907 398..802 100 -> Plus
2L 14616978..14617405 803..1232 99   Plus
2L 14615555..14615643 1..88 98 -> Plus

RH54514.pep Sequence

Translation from 298 to 1068

> RH54514.pep
MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAEL
KAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDH
QIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQV
PVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHTFNSWLDV
EPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTK
HWDSGI*

RH54514.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Adh-PA 256 GF14888-PA 1..256 1..256 1237 91.8 Plus
Dana\GF12913-PA 372 GF12913-PA 124..372 8..256 1003 77.9 Plus
Dana\Adhr-PA 272 GF14889-PA 2..253 3..252 444 36.9 Plus
Dana\GF10118-PA 259 GF10118-PA 3..253 5..252 382 35.4 Plus
Dana\GF24389-PA 261 GF24389-PA 1..254 1..252 310 30.9 Plus
Dana\GF12913-PA 372 GF12913-PA 16..67 2..53 162 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Adh-PA 256 GG25120-PA 1..256 1..256 1285 95.7 Plus
Dere\Adhr-PA 272 GG25121-PA 2..253 3..252 464 38.5 Plus
Dere\GG16001-PA 259 GG16001-PA 3..253 5..252 348 34.7 Plus
Dere\GG25347-PA 256 GG25347-PA 2..255 3..253 334 28.9 Plus
Dere\GG13462-PA 261 GG13462-PA 1..254 1..252 312 30.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\Adh-PA 254 GH13025-PA 1..254 3..256 1080 78.3 Plus
Dgri\GH13846-PA 249 GH13846-PA 2..246 5..249 809 60.8 Plus
Dgri\GH13026-PA 239 GH13026-PA 1..239 21..256 767 60.3 Plus
Dgri\GH13404-PA 274 GH13404-PA 2..253 3..252 403 35 Plus
Dgri\GH13403-PA 169 GH13403-PA 35..168 8..154 370 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Adh-PE 256 CG3481-PE 1..256 1..256 1316 100 Plus
Adh-PF 256 CG3481-PF 1..256 1..256 1316 100 Plus
Adh-PH 256 CG3481-PH 1..256 1..256 1316 100 Plus
Adh-PI 256 CG3481-PI 1..256 1..256 1316 100 Plus
Adh-PC 256 CG3481-PC 1..256 1..256 1316 100 Plus
Adhr-PC 272 CG3484-PC 2..253 3..252 449 38.2 Plus
Adhr-PB 272 CG3484-PB 2..253 3..252 449 38.2 Plus
Adhr-PA 272 CG3484-PA 2..253 3..252 449 38.2 Plus
CG18814-PB 267 CG18814-PB 3..255 5..253 368 34.4 Plus
CG4842-PA 259 CG4842-PA 3..253 5..252 342 31.7 Plus
Fbp2-PC 256 CG3763-PC 2..254 3..252 329 29.4 Plus
Fbp2-PB 256 CG3763-PB 2..254 3..252 329 29.4 Plus
Fbp2-PA 256 CG3763-PA 2..254 3..252 329 29.4 Plus
Pdh-PC 261 CG4899-PC 1..254 1..252 312 30.4 Plus
Pdh-PA 278 CG4899-PA 18..271 1..252 312 30.4 Plus
Pdh-PD 260 CG4899-PD 1..253 1..252 300 30.4 Plus
Pdh-PB 277 CG4899-PB 18..270 1..252 300 30.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Adh2-PA 254 GI17643-PA 1..254 3..256 1113 81.1 Plus
Dmoj\Adh1-PA 254 GI17644-PA 1..254 3..256 1084 79.1 Plus
Dmoj\GI17642-PA 291 GI17642-PA 40..291 5..256 981 72.6 Plus
Dmoj\GI10333-PA 238 GI10333-PA 1..238 21..256 725 55 Plus
Dmoj\GI17645-PA 276 GI17645-PA 2..253 3..252 441 36.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\Adh-PA 254 GL25993-PA 1..254 3..256 1233 91.3 Plus
Dper\GL26015-PA 820 GL26015-PA 567..820 3..256 1172 85 Plus
Dper\Adhr-PA 267 GL25994-PA 2..242 3..252 415 35.2 Plus
Dper\GL17859-PA 258 GL17859-PA 3..257 5..256 362 33.6 Plus
Dper\GL26147-PA 256 GL26147-PA 2..255 3..253 314 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Adh-PA 254 GA17214-PA 1..254 3..256 1229 90.9 Plus
Dpse\GA25238-PA 820 GA25238-PA 567..820 3..256 1172 85 Plus
Dpse\GA25237-PA 820 GA25237-PA 567..820 3..256 1171 85 Plus
Dpse\Adhr-PA 278 GA25223-PA 2..253 3..252 446 37.3 Plus
Dpse\GA18471-PA 258 GA18471-PA 3..257 5..256 366 33.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Adh-PA 256 GM15656-PA 1..256 1..256 1319 98.8 Plus
Dsec\Adhr-PA 272 GM15667-PA 2..253 3..252 464 38.5 Plus
Dsec\GM25633-PA 267 GM25633-PA 3..248 5..246 355 35.3 Plus
Dsec\GM17449-PA 256 GM17449-PA 2..255 3..253 342 29.3 Plus
Dsec\GM25632-PA 259 GM25632-PA 3..253 5..252 339 31.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Adh-PA 256 GD23968-PA 1..256 1..256 1319 98.8 Plus
Dsim\Adhr-PA 272 GD23969-PA 2..253 3..252 464 38.5 Plus
Dsim\Fbp2-PA 256 GD23602-PA 2..255 3..253 341 29.3 Plus
Dsim\GD14635-PA 259 GD14635-PA 3..253 5..252 339 31.7 Plus
Dsim\GD12481-PA 261 GD12481-PA 1..254 1..252 313 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Adh1-PA 254 GJ18208-PA 1..254 3..256 1104 80.7 Plus
Dvir\Adh2-PA 254 GJ18209-PA 1..254 3..256 1104 80.7 Plus
Dvir\Adhr-PA 275 GJ18210-PA 2..253 3..252 438 36.5 Plus
Dvir\GJ12792-PA 259 GJ12792-PA 3..253 5..252 378 35.3 Plus
Dvir\GJ12626-PA 261 GJ12626-PA 1..254 1..252 311 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Adh-PA 254 GK18290-PA 3..254 5..256 1195 88.9 Plus
Dwil\GK14700-PA 254 GK14700-PA 3..254 5..256 976 70.2 Plus
Dwil\GK14701-PA 254 GK14701-PA 3..254 5..256 939 68.3 Plus
Dwil\GK18292-PA 273 GK18292-PA 2..253 3..252 447 36.9 Plus
Dwil\GK14485-PA 260 GK14485-PA 3..254 5..252 335 31.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Adh-PA 256 GE19037-PA 1..256 1..256 1313 97.3 Plus
Dyak\jgw-PA 323 GE10683-PA 69..323 2..256 1236 91 Plus
Dyak\Adhr-PA 272 GE19038-PA 2..253 3..252 465 38.9 Plus
Dyak\GE23095-PA 260 GE23095-PA 3..255 5..253 360 34.4 Plus
Dyak\GE23092-PA 259 GE23092-PA 3..253 5..252 358 33.6 Plus

RH54514.hyp Sequence

Translation from 298 to 1068

> RH54514.hyp
MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAEL
KAINPKVTVTFYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDH
QIERTIAVNYTGLVNTTTAILDFWDKRKGGPGGIICNIGSVTGFNAIYQV
PVYSGTKAAVVNFTSSLAKLAPITGVTAYTVNPGITRTTLVHTFNSWLDV
EPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDLGTLEAIQWTK
HWDSGI*

RH54514.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Adh-PE 256 CG3481-PE 1..256 1..256 1316 100 Plus
Adh-PF 256 CG3481-PF 1..256 1..256 1316 100 Plus
Adh-PH 256 CG3481-PH 1..256 1..256 1316 100 Plus
Adh-PI 256 CG3481-PI 1..256 1..256 1316 100 Plus
Adh-PC 256 CG3481-PC 1..256 1..256 1316 100 Plus