Clone RH54517 Report

Search the DGRC for RH54517

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:545
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG12279-RA
Protein status:RH54517.pep: gold
Preliminary Size:600
Sequenced Size:487

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12279 2001-12-13 Blastp of sequenced clone
CG12279 2002-01-01 Sim4 clustering to Release 2
CG12279 2003-01-01 Sim4 clustering to Release 3
CG12279 2008-04-29 Release 5.5 accounting
CG12279 2008-08-15 Release 5.9 accounting
CG12279 2008-12-18 5.12 accounting

Clone Sequence Records

RH54517.complete Sequence

487 bp (487 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070705

> RH54517.complete
GACACCTCAAACCGGGCTAACTTTTGAGTTCAACTAAGTTCTTTAAGAAT
TACCATTAAAAATAAATATGGCCACCTACGAGGAAGTCAAGGACATTCCA
AACCACCCGGAGAAGTACCTGTTCGATGTGCGCAACGAGTCGGAGCTGAA
GGAGACGGGCGTCCTGCCCGCCAGCATAAACATTCCACTGAGCGAGCTGG
AGAAGGCACTGAACTTGCCGGAGGAGGACTTCGCCCAGACTTATGGACGC
GTCAAGCCGGCCGTCGATGCGGTCTTGATCTTCTCGTGCAAGGCGGGAGG
ACGCGCTGCCCGGGCGGCCAATCTGGCCAGCACGCTGGGCTTCACCAACG
CCAAGGCTTATGCCGGATCATGGACGGAGTGGCAGGCCAAGCAGTCCTAA
AACATTCAGTCTTTAAACAAATTGATTACAAATCTATAAAATGATATAAT
AAACTACACGCTAACTTCCTTAAAAAAAAAAAAAAAA

RH54517.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-RA 779 CG12279-RA 154..626 2..474 2365 100 Plus
mus308-RA 6435 mus308-RA 6267..6392 474..349 630 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8530342..8530528 2..188 935 100 Plus
chr3R 27901430 chr3R 8530585..8530750 183..348 815 99.4 Plus
chr3R 27901430 chr3R 8530813..8530935 349..471 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12705095..12705281 2..188 935 100 Plus
3R 32079331 3R 12705338..12705503 183..348 815 99.4 Plus
3R 32079331 3R 12705566..12705691 349..474 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12445926..12446112 2..188 935 100 Plus
3R 31820162 3R 12446169..12446334 183..348 815 99.3 Plus
3R 31820162 3R 12446397..12446522 349..474 630 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:09:32 has no hits.

RH54517.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:10:21 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8530341..8530528 1..188 99 -> Plus
chr3R 8530591..8530750 189..348 100 -> Plus
chr3R 8530813..8530935 349..471 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:45 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 68..400 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:16:54 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 68..400 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:07:05 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 68..400 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:43:00 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 68..400 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:58:24 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 1..333 68..400 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:49:22 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 2..471 2..471 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:16:53 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 2..471 2..471 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:07:05 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 2..471 2..471 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:43:00 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 2..471 2..471 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:58:24 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12279-RA 2..471 2..471 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:21 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12705094..12705281 1..188 99 -> Plus
3R 12705344..12705503 189..348 100 -> Plus
3R 12705566..12705688 349..471 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:21 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12705094..12705281 1..188 99 -> Plus
3R 12705344..12705503 189..348 100 -> Plus
3R 12705566..12705688 349..471 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:10:21 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12705094..12705281 1..188 99 -> Plus
3R 12705344..12705503 189..348 100 -> Plus
3R 12705566..12705688 349..471 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:07:05 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8530816..8531003 1..188 99 -> Plus
arm_3R 8531066..8531225 189..348 100 -> Plus
arm_3R 8531288..8531410 349..471 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:19:07 Download gff for RH54517.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12445925..12446112 1..188 99 -> Plus
3R 12446175..12446334 189..348 100 -> Plus
3R 12446397..12446519 349..471 100   Plus

RH54517.hyp Sequence

Translation from 67 to 399

> RH54517.hyp
MATYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNL
PEEDFAQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAG
SWTEWQAKQS*

RH54517.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-PA 110 CG12279-PA 1..110 1..110 566 100 Plus
Hsp67Bb-PD 111 CG4456-PD 1..109 1..109 326 53.2 Plus
Hsp67Bb-PC 111 CG4456-PC 1..109 1..109 326 53.2 Plus
Hsp67Bb-PB 111 CG4456-PB 1..109 1..109 326 53.2 Plus
Hsp67Bb-PA 111 CG4456-PA 1..109 1..109 326 53.2 Plus

RH54517.pep Sequence

Translation from 67 to 399

> RH54517.pep
MATYEEVKDIPNHPEKYLFDVRNESELKETGVLPASINIPLSELEKALNL
PEEDFAQTYGRVKPAVDAVLIFSCKAGGRAARAANLASTLGFTNAKAYAG
SWTEWQAKQS*

RH54517.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17119-PA 113 GF17119-PA 1..110 1..110 443 82.7 Plus
Dana\GF10688-PA 139 GF10688-PA 29..137 1..109 354 58.7 Plus
Dana\GF20128-PA 139 GF20128-PA 29..137 1..109 328 55 Plus
Dana\GF17037-PA 156 GF17037-PA 44..152 1..109 258 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19214-PA 110 GG19214-PA 1..110 1..110 501 95.5 Plus
Dere\GG15366-PA 111 GG15366-PA 1..109 1..109 325 52.3 Plus
Dere\GG11250-PA 155 GG11250-PA 43..147 1..105 267 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25246-PA 111 GH25246-PA 1..110 1..110 427 80 Plus
Dgri\GH18596-PA 111 GH18596-PA 1..110 1..110 427 80 Plus
Dgri\GH14585-PA 113 GH14585-PA 1..109 1..109 351 59.6 Plus
Dgri\GH18488-PA 125 GH18488-PA 13..121 1..109 244 45 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12279-PA 110 CG12279-PA 1..110 1..110 566 100 Plus
CG4456-PD 111 CG4456-PD 1..109 1..109 326 53.2 Plus
CG4456-PC 111 CG4456-PC 1..109 1..109 326 53.2 Plus
CG4456-PB 111 CG4456-PB 1..109 1..109 326 53.2 Plus
CG4456-PA 111 CG4456-PA 1..109 1..109 326 53.2 Plus
CG6000-PC 154 CG6000-PC 45..150 4..109 269 48.1 Plus
CG6000-PD 154 CG6000-PD 45..150 4..109 269 48.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10805-PA 111 GI10805-PA 1..110 1..110 418 79.1 Plus
Dmoj\GI12243-PA 114 GI12243-PA 3..110 2..109 352 59.3 Plus
Dmoj\GI24633-PA 172 GI24633-PA 60..164 1..105 250 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24425-PA 112 GL24425-PA 1..109 1..109 490 81.7 Plus
Dper\GL22440-PA 111 GL22440-PA 1..109 1..109 338 54.1 Plus
Dper\GL23397-PA 159 GL23397-PA 47..155 1..109 243 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11529-PA 112 GA11529-PA 1..109 1..109 490 81.7 Plus
Dpse\GA24291-PA 111 GA24291-PA 1..109 1..109 334 53.2 Plus
Dpse\GA27244-PA 159 GA27244-PA 47..155 1..109 244 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:32:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24062-PA 110 GM24062-PA 1..110 1..110 512 95.5 Plus
Dsec\GM25139-PA 111 GM25139-PA 1..109 1..109 335 53.2 Plus
Dsec\GM26554-PA 153 GM26554-PA 41..145 1..105 257 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18858-PA 110 GD18858-PA 1..110 1..110 515 95.5 Plus
Dsim\GD14173-PA 111 GD14173-PA 1..109 1..109 335 53.2 Plus
Dsim\GD21060-PA 153 GD21060-PA 41..145 1..105 257 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14403-PA 111 GJ14403-PA 1..110 1..110 424 78.2 Plus
Dvir\GJ11475-PA 183 GJ11475-PA 72..179 2..109 353 59.3 Plus
Dvir\GJ14195-PA 171 GJ14195-PA 62..163 4..105 255 49 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13732-PA 111 GK13732-PA 1..110 1..110 431 82.7 Plus
Dwil\GK17634-PA 112 GK17634-PA 1..109 1..109 328 53.2 Plus
Dwil\GK11151-PA 155 GK11151-PA 43..151 1..109 278 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26219-PA 110 GE26219-PA 1..110 1..110 503 95.5 Plus
Dyak\Hsp67Bb-PA 111 GE20829-PA 1..109 1..109 340 55 Plus
Dyak\GE23442-PA 155 GE23442-PA 43..147 1..105 262 49.5 Plus