Clone RH55324 Report

Search the DGRC for RH55324

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:553
Well:24
Vector:pFlc-1
Associated Gene/TranscripteIF4E-6-RA
Protein status:RH55324.pep: gold
Preliminary Size:522
Sequenced Size:694

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1442 2002-01-01 Sim4 clustering to Release 2
CG1442 2002-03-20 Blastp of sequenced clone
eIF4E-6 2008-04-29 Release 5.5 accounting
eIF4E-6 2008-08-15 Release 5.9 accounting
eIF4E-6 2008-12-18 5.12 accounting

Clone Sequence Records

RH55324.complete Sequence

694 bp (694 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094939

> RH55324.complete
GAATCACGATTGTTTCCTAATTGACAGTGCATTGCTTTAACGTCAATAAT
TAAATGATCAAATGCTCTAAGCTTGACCACATTCGTCGGGGGCTTCAGCA
TAGAGTATCTGCGAAATGGAAAACTTAAGGCAAACCAAAGAGTCATCGGA
ATTTAAAATGGGGACTTCTCTGGATAATAACAAACTGGCATCGTTGGGTG
CCACAAACAAGCACCGGCTGCAGAACACATGGACCCTGTGGGGCGTAAAG
TACGACCCTGAAATATCATGGGAGGACATGCTGAAGGAGATTGACAGCTT
CAATACCGTCGAGGACTTCTGGAACCTGTATTTCCGCATCGATACGCCAT
CCAAGCTCAACCGCGGCTGTGATTACATGCTCTTCAAGAAGGGCATTCGC
CCCATGTGGGAGGATCCGCCGAACAAGGGCGGAGGTCGTTGGACATATAA
AGTGGATAAAAGGTCCACAGCCGAACTGGACAAAACTTGGCTGGACGTGC
TTCTTTGCATGATTGGCGAGGCCTGCGATCACTGCGATCAGATTTGTGGG
GCTTTTGTCAGGATTCGCAAAAATATCAACAAAATCTCCGTATGGACAAA
GGCAGACGCGGGCGATGAGTGTAACGAACAGTGCTAAAATCCCAAAGAGA
CGAATAAACTAACTATTGCACATCCCCCAAAAAAAAAAAAAAAA

RH55324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
eIF4E-6-RA 713 eIF4E-6-RA 1..679 2..680 3380 99.8 Plus
eIF-4E-RG 1380 eIF-4E-RG 639..785 269..415 255 78.2 Plus
eIF-4E-RC 1453 eIF-4E-RC 674..820 269..415 255 78.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:55:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24849410..24849998 676..88 2915 99.7 Minus
chr3R 27901430 chr3R 24850056..24850143 89..2 440 100 Minus
chr3L 24539361 chr3L 9392480..9392610 399..269 190 76.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29026437..29027029 680..88 2950 99.8 Minus
3R 32079331 3R 29027087..29027174 89..2 440 100 Minus
3L 28110227 3L 9400583..9400713 399..269 190 76.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28767268..28767860 680..88 2950 99.8 Minus
3R 31820162 3R 28767918..28768005 89..2 440 100 Minus
3L 28103327 3L 9393683..9393813 399..269 190 76.3 Minus
Blast to na_te.dros performed on 2019-03-15 22:55:20 has no hits.

RH55324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:55:59 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24849408..24849997 89..678 99 <- Minus
chr3R 24850057..24850143 1..88 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:51 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..522 116..637 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:25:47 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RC 1..522 116..637 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:23:42 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..522 116..637 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:01:06 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..522 116..637 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:15 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..522 116..637 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:52:20 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..677 2..678 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:25:47 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..677 2..678 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:23:42 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..677 2..678 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:01:06 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..677 2..678 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:15 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
eIF4E-6-RA 1..677 2..678 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:59 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29026439..29027028 89..678 99 <- Minus
3R 29027088..29027174 1..88 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:59 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29026439..29027028 89..678 99 <- Minus
3R 29027088..29027174 1..88 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:55:59 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29026439..29027028 89..678 99 <- Minus
3R 29027088..29027174 1..88 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:23:42 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24852161..24852750 89..678 99 <- Minus
arm_3R 24852810..24852896 1..88 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:34:17 Download gff for RH55324.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28767270..28767859 89..678 99 <- Minus
3R 28767919..28768005 1..88 98   Minus

RH55324.pep Sequence

Translation from 115 to 636

> RH55324.pep
MENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDPEI
SWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWED
PPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRI
RKNINKISVWTKADAGDECNEQC*

RH55324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23736-PA 261 GF23736-PA 82..219 32..169 457 61.6 Plus
Dana\GF22031-PA 458 GF22031-PA 280..415 33..169 416 54 Plus
Dana\GF10894-PA 230 GF10894-PA 52..181 32..161 406 56.9 Plus
Dana\GF10327-PA 271 GF10327-PA 61..222 2..161 392 44.4 Plus
Dana\GF25106-PA 244 GF25106-PA 66..196 32..162 375 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12044-PA 207 GG12044-PA 1..161 1..163 579 67.5 Plus
Dere\GG14044-PA 250 GG14044-PA 71..208 32..169 438 59.4 Plus
Dere\GG15032-PA 229 GG15032-PA 51..180 32..161 417 58.5 Plus
Dere\GG12718-PA 448 GG12718-PA 270..405 33..169 402 53.3 Plus
Dere\GG14453-PA 231 GG14453-PA 53..182 32..161 387 53.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16860-PA 275 GH16860-PA 96..233 32..169 447 60.9 Plus
Dgri\GH15637-PA 233 GH15637-PA 41..184 18..161 409 54.2 Plus
Dgri\GH14978-PA 232 GH14978-PA 54..190 32..169 391 50 Plus
Dgri\GH24331-PA 222 GH24331-PA 7..172 2..161 387 47.9 Plus
Dgri\GH12729-PA 300 GH12729-PA 108..257 19..169 381 47 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
eIF4E6-PC 173 CG1442-PC 1..173 1..173 964 100 Plus
eIF4E6-PB 173 CG1442-PB 1..173 1..173 964 100 Plus
eIF4E6-PA 173 CG1442-PA 1..173 1..173 964 100 Plus
eIF4E1-PC 248 CG4035-PC 69..204 32..168 448 60.6 Plus
eIF4E1-PI 259 CG4035-PI 80..215 32..168 448 60.6 Plus
eIF4E1-PH 259 CG4035-PH 80..215 32..168 448 60.6 Plus
eIF4E1-PD 259 CG4035-PD 80..215 32..168 448 60.6 Plus
eIF4E1-PB 259 CG4035-PB 80..215 32..168 448 60.6 Plus
eIF4E1-PF 259 CG4035-PF 80..215 32..168 448 60.6 Plus
eIF4E1-PE 259 CG4035-PE 80..215 32..168 448 60.6 Plus
eIF4E1-PG 259 CG4035-PG 80..215 32..168 448 60.6 Plus
eIF4E1-PA 259 CG4035-PA 80..215 32..168 448 60.6 Plus
eIF4E4-PA 229 CG10124-PA 51..180 32..161 418 56.9 Plus
eIF4E5-PA 232 CG8277-PA 54..183 32..161 401 53.8 Plus
eIF4E7-PA 429 CG32859-PA 250..385 32..168 401 52.6 Plus
eIF4E3-PA 244 CG8023-PA 66..196 32..162 399 52.7 Plus
eIF4EHP-PA 223 CG33100-PA 21..173 9..160 212 30.1 Plus
eIF4EHP-PD 242 CG33100-PD 21..173 9..160 212 30.1 Plus
eIF4EHP-PC 186 CG33100-PC 21..164 9..151 197 29.9 Plus
eIF4EHP-PB 248 CG33100-PB 21..164 9..151 197 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12684-PA 246 GI12684-PA 68..197 32..161 410 57.7 Plus
Dmoj\GI13141-PA 238 GI13141-PA 60..189 32..161 389 52.3 Plus
Dmoj\GI14982-PA 311 GI14982-PA 133..261 33..161 382 53.5 Plus
Dmoj\GI23433-PA 171 GI23433-PA 29..166 19..155 198 31.2 Plus
Dmoj\GI16776-PA 198 GI16776-PA 99..162 32..95 185 54.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12850-PA 198 GL12850-PA 19..154 32..168 446 62 Plus
Dper\GL13241-PA 223 GL13241-PA 40..174 27..161 397 53.3 Plus
Dper\GL26506-PA 219 GL26506-PA 33..174 24..165 372 48.6 Plus
Dper\GL14400-PA 233 GL14400-PA 54..183 32..161 352 50 Plus
Dper\GL24147-PA 231 GL24147-PA 31..169 19..156 193 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28658-PA 263 GA28658-PA 84..219 32..168 449 62 Plus
Dpse\GA28599-PA 223 GA28599-PA 40..174 27..161 399 53.3 Plus
Dpse\GA28380-PA 227 GA28380-PA 48..185 31..169 378 48.9 Plus
Dpse\GA28966-PA 219 GA28966-PA 33..174 24..165 372 48.6 Plus
Dpse\GA24628-PA 234 GA24628-PA 55..186 31..162 372 51.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12271-PA 199 GM12271-PA 1..169 1..169 799 88.2 Plus
Dsec\GM24878-PA 269 GM24878-PA 90..227 32..169 438 58.7 Plus
Dsec\GM13832-PA 229 GM13832-PA 51..180 32..161 413 57.7 Plus
Dsec\GM25004-PA 233 GM25004-PA 55..184 32..161 402 53.1 Plus
Dsec\GM25034-PA 244 GM25034-PA 66..196 32..162 383 52.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18002-PA 200 GD18002-PA 1..169 1..169 793 87 Plus
Dsim\GD12928-PA 269 GD12928-PA 90..227 32..169 439 58.7 Plus
Dsim\GD13118-PA 229 GD13118-PA 51..180 32..161 414 57.7 Plus
Dsim\GD14038-PA 233 GD14038-PA 55..184 32..161 406 54.6 Plus
Dsim\GD14067-PA 244 GD14067-PA 66..196 32..162 384 52.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13832-PA 272 GJ13832-PA 93..230 32..169 454 61.6 Plus
Dvir\GJ19475-PA 323 GJ19475-PA 144..273 32..161 426 61.5 Plus
Dvir\GJ12668-PA 230 GJ12668-PA 52..181 32..161 411 57.7 Plus
Dvir\GJ13889-PA 238 GJ13889-PA 60..189 32..161 392 52.3 Plus
Dvir\GJ16331-PA 301 GJ16331-PA 123..257 33..168 388 52.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14373-PA 235 GK14373-PA 53..194 28..173 439 57.5 Plus
Dwil\GK20927-PA 266 GK20927-PA 87..224 32..169 438 59.4 Plus
Dwil\GK25580-PA 300 GK25580-PA 121..250 32..161 430 61.5 Plus
Dwil\GK12168-PA 260 GK12168-PA 81..218 32..169 420 58.7 Plus
Dwil\GK16243-PA 360 GK16243-PA 178..317 29..169 416 54.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10483-PA 212 GE10483-PA 1..168 1..170 583 64.7 Plus
Dyak\GE21247-PA 269 GE21247-PA 90..227 32..169 440 59.4 Plus
Dyak\GE20475-PA 229 GE20475-PA 51..180 32..161 412 57.7 Plus
Dyak\GE16544-PA 448 GE16544-PA 247..405 9..169 410 47.8 Plus
Dyak\GE21642-PA 231 GE21642-PA 53..182 32..161 396 53.1 Plus

RH55324.hyp Sequence

Translation from 115 to 636

> RH55324.hyp
MENLRQTKESSEFKMGTSLDNNKLASLGATNKHRLQNTWTLWGVKYDPEI
SWEDMLKEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWED
PPNKGGGRWTYKVDKRSTAELDKTWLDVLLCMIGEACDHCDQICGAFVRI
RKNINKISVWTKADAGDECNEQC*

RH55324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
eIF4E-6-PC 173 CG1442-PC 1..173 1..173 964 100 Plus
eIF4E-6-PB 173 CG1442-PB 1..173 1..173 964 100 Plus
eIF4E-6-PA 173 CG1442-PA 1..173 1..173 964 100 Plus
eIF-4E-PC 248 CG4035-PC 69..204 32..168 448 60.6 Plus
eIF-4E-PI 259 CG4035-PI 80..215 32..168 448 60.6 Plus