Clone RH55360 Report

Search the DGRC for RH55360

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:553
Well:60
Vector:pFlc-1
Associated Gene/TranscriptRPA3-RA
Protein status:RH55360.pep: gold
Preliminary Size:339
Sequenced Size:557

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15220 2002-01-01 Sim4 clustering to Release 2
CG15220 2002-04-21 Blastp of sequenced clone
CG15220 2003-01-01 Sim4 clustering to Release 3
CG15220 2008-04-29 Release 5.5 accounting
CG15220 2008-08-15 Release 5.9 accounting
CG15220 2008-12-18 5.12 accounting

Clone Sequence Records

RH55360.complete Sequence

557 bp (557 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113602

> RH55360.complete
GAACTATTGGCGCTCTTTCTTGTTTACGGCATTTCATTTTCTGCTGAAAT
TGGCTGTTTTTTGAACGTTATTAACTGAGGAGTTATTATGGATGCCTTTG
ATCCACGCTCGATTATCAACGGCGGCATGCTGAAGCAGTTTTCCGGCCAA
ACCGTGAGCATAATGGTTCGCGTGGAGAGCGTCGCGGGATCCACTTTGCT
GGCCAGTTCCACAGACAACCACAAGCTAAAGATCAATCTGCCGGGTGAGC
TGGGCGCCGCCGAAGGGGCCTGGGTCGAGGTCATTGGAGTGCCCCATGGT
GCGGACACCCTCAGGGCCAAGGAGGTCATCGAGTTTGGCGGCGAGAACAT
CGACTTCGATAAGGATGGCTATAATGGATTGAGCCACCTGATTAACAATG
TCAAGGCCTTCTATCGCAGCGGCTAGGATGTCCACAATTATATCTAAGAA
TTAATATTATGTACTCTAATGTTATTTTTTCCATTTTTTTGGAGAACACT
CAGAGCTGGCATTAACTTTAAATATAAATCATCTATCTACATAAAAAAAA
AAAAAAA

RH55360.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15220-RA 716 CG15220-RA 43..584 2..543 2710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11506709..11507033 326..2 1625 100 Minus
chrX 22417052 chrX 11506422..11506641 542..323 1100 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11615516..11615840 326..2 1625 100 Minus
X 23542271 X 11615228..11615448 543..323 1105 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11623614..11623938 326..2 1625 100 Minus
X 23527363 X 11623326..11623546 543..323 1105 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:19:11 has no hits.

RH55360.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:20:28 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11506422..11506639 325..542 100 <- Minus
chrX 11506711..11507033 1..324 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:49:52 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..339 88..426 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:11:17 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..339 88..426 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:18 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..339 88..426 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:55:56 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..339 88..426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:16:41 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
RPA3-RA 1..339 88..426 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:05:12 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..541 2..542 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:11:16 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..541 2..542 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:18 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..541 2..542 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:55:56 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
CG15220-RA 1..541 2..542 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:41 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
RPA3-RA 1..541 2..542 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:28 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
X 11615229..11615446 325..542 100 <- Minus
X 11615518..11615840 1..324 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:28 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
X 11615229..11615446 325..542 100 <- Minus
X 11615518..11615840 1..324 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:28 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
X 11615229..11615446 325..542 100 <- Minus
X 11615518..11615840 1..324 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:18 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11509262..11509479 325..542 100 <- Minus
arm_X 11509551..11509873 1..324 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:31:09 Download gff for RH55360.complete
Subject Subject Range Query Range Percent Splice Strand
X 11623327..11623544 325..542 100 <- Minus
X 11623616..11623938 1..324 99   Minus

RH55360.pep Sequence

Translation from 87 to 425

> RH55360.pep
MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLASSTDNHKLKIN
LPGELGAAEGAWVEVIGVPHGADTLRAKEVIEFGGENIDFDKDGYNGLSH
LINNVKAFYRSG*

RH55360.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19441-PA 113 GF19441-PA 2..113 1..112 533 86.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18844-PA 112 GG18844-PA 1..112 1..112 564 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24192-PA 113 GH24192-PA 5..113 4..112 467 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
RPA3-PB 112 CG15220-PB 1..112 1..112 574 100 Plus
RPA3-PA 112 CG15220-PA 1..112 1..112 574 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14830-PA 113 GI14830-PA 5..113 4..112 447 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13581-PA 113 GA13581-PA 2..113 1..112 506 83 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13057-PA 112 GM13057-PA 1..112 1..112 584 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15982-PA 112 GD15982-PA 1..112 1..112 584 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19496-PA 113 GJ19496-PA 5..113 4..112 449 72.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10101-PA 112 GK10101-PA 2..112 3..112 464 78.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:51:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17609-PA 112 GE17609-PA 1..112 1..112 580 98.2 Plus

RH55360.hyp Sequence

Translation from 87 to 425

> RH55360.hyp
MDAFDPRSIINGGMLKQFSGQTVSIMVRVESVAGSTLLASSTDNHKLKIN
LPGELGAAEGAWVEVIGVPHGADTLRAKEVIEFGGENIDFDKDGYNGLSH
LINNVKAFYRSG*

RH55360.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
RPA3-PB 112 CG15220-PB 1..112 1..112 574 100 Plus
RPA3-PA 112 CG15220-PA 1..112 1..112 574 100 Plus