RH55750.complete Sequence
727 bp (727 high quality bases) assembled on 2004-10-04
GenBank Submission: BT021219
> RH55750.complete
GAGTCAAATTCAAGTGTTCAAGTGAAGCAGTCGAAACATAAGCAACAGAT
TCCGCAGCAGTTATATCCAGTTCAGAGAAACAGTAGTTAATCAGTAATTA
AAGTGTTGAGTGAATTTCTTATCGGGTCAGTTGTAAACTAGTGCAAAAAT
GTCGCAATCCGATAACGTGGCACGTGAGCAAACTGCGGCAAATGCAGGGC
CGGATGCATGTCAAGGATGCCGCGGCCAATTGCCAAATGCCACGCCCGTG
GAAGTCGAGGACATGGCCTTGCCGTCGATGGAGCGTCTCATTCGAAAGGC
CAACATGGCCCAGAAAATGCTGAACGATGTGATGAAACAGATCCAGAAGC
AGCAGCAGCAGGAATCTCAACTCTCCATCAAGGAGACCAAGTCCAAGCAC
CGCAGCTCCGATGGAGTTCCAGTTCCGACCACAGTGACTGCGAGCTGATC
CTGGCGGAGAAGGAGGGGCACATGCCGCGGAGAAGACACACGCGAGATGA
CCGCAAGCGGGATCGTTCCCGGTCTCGCGGTCGCTCCCGTGGTCACTCGC
GTGGTCGTTCTCATGGGCGTTCTCGTCCCAGGTCCTACACCGATTCCCGA
CGATCTCGAGCACTACCCCTGGCTCTGCCCGTTCGGATTTCAGTGTGAGT
ATCTGGCTTCATTCAGTATTATTCAATATTCATTTTATATATTAAGTGCG
CATAAAAAAACCAAAAAAAAAAAAAAA
RH55750.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:57:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8620-RA | 858 | CG8620-RA | 112..835 | 2..725 | 3605 | 99.8 | Plus |
CG8620-RB | 788 | CG8620-RB | 1..415 | 2..416 | 2075 | 100 | Plus |
CG8620-RB | 788 | CG8620-RB | 478..788 | 415..725 | 1540 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:46:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 7150295..7150709 | 2..416 | 2045 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 7150772..7151069 | 415..712 | 1475 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:46:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 7158100..7158514 | 2..416 | 2075 | 100 | Plus |
3L | 28110227 | 3L | 7158577..7158887 | 415..725 | 1540 | 99.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 7151200..7151614 | 2..416 | 2075 | 100 | Plus |
3L | 28103327 | 3L | 7151677..7151987 | 415..725 | 1540 | 99.6 | Plus |
Blast to na_te.dros performed on 2019-03-15 16:46:55 has no hits.
RH55750.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:11 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 7150294..7150709 | 1..416 | 99 | -> | Plus |
chr3L | 7150774..7151060 | 417..703 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:02 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 1..300 | 149..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:30:52 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 1..300 | 149..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:42 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 1..300 | 149..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:14:45 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 1..300 | 149..448 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:51 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 1..300 | 149..448 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:35:25 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 2..712 | 2..712 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:30:52 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 2..712 | 2..712 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:42 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 2..712 | 2..712 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:14:45 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 2..712 | 2..712 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:51 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8620-RA | 2..712 | 2..712 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7158099..7158514 | 1..416 | 99 | -> | Plus |
3L | 7158579..7158874 | 417..712 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7158099..7158514 | 1..416 | 99 | -> | Plus |
3L | 7158579..7158874 | 417..712 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7158099..7158514 | 1..416 | 99 | -> | Plus |
3L | 7158579..7158874 | 417..712 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:42 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 7151679..7151974 | 417..712 | 99 | | Plus |
arm_3L | 7151199..7151614 | 1..416 | 99 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:51:36 Download gff for
RH55750.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 7151199..7151614 | 1..416 | 99 | -> | Plus |
3L | 7151679..7151974 | 417..712 | 99 | | Plus |
RH55750.pep Sequence
Translation from 148 to 447
> RH55750.pep
MSQSDNVAREQTAANAGPDACQGCRGQLPNATPVEVEDMALPSMERLIRK
ANMAQKMLNDVMKQIQKQQQQESQLSIKETKSKHRSSDGVPVPTTVTAS*
RH55750.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF25013-PA | 187 | GF25013-PA | 1..88 | 1..89 | 267 | 73 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10954-PA | 180 | GG10954-PA | 1..85 | 1..89 | 385 | 86.5 | Plus |
Dere\GG14409-PA | 180 | GG14409-PA | 1..85 | 1..89 | 385 | 86.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8620-PA | 99 | CG8620-PA | 1..99 | 1..99 | 498 | 100 | Plus |
CG8620-PB | 187 | CG8620-PB | 1..89 | 1..89 | 449 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:49:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25232-PA | 183 | GL25232-PA | 1..90 | 1..89 | 206 | 53.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:49:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA23734-PA | 183 | GA23734-PA | 1..90 | 1..89 | 201 | 52.1 | Plus |
Dpse\GA21213-PA | 183 | GA21213-PA | 1..90 | 1..89 | 201 | 52.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:49:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14824-PA | 186 | GM14824-PA | 1..89 | 1..89 | 361 | 95.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:49:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13998-PA | 99 | GD13998-PA | 1..99 | 1..99 | 412 | 96 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13652-PA | 75 | GJ13652-PA | 1..69 | 1..69 | 149 | 42 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16754-PA | 197 | GK16754-PA | 13..72 | 10..69 | 208 | 65 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:49:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21598-PA | 185 | GE21598-PA | 1..89 | 1..89 | 347 | 86.5 | Plus |
RH55750.hyp Sequence
Translation from 207 to 647
> RH55750.hyp
MSRMPRPIAKCHARGSRGHGLAVDGASHSKGQHGPENAERCDETDPEAAA
AGISTLHQGDQVQAPQLRWSSSSDHSDCELILAEKEGHMPRRRHTRDDRK
RDRSRSRGRSRGHSRGRSHGRSRSRSYTDSRRSRALPLALPVRISV*
RH55750.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8620-PB | 187 | CG8620-PB | 111..187 | 70..146 | 395 | 100 | Plus |