Clone RH55750 Report

Search the DGRC for RH55750

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:557
Well:50
Vector:pFlc-1
Associated Gene/TranscriptCG8620-RA
Protein status:RH55750.pep: gold
Preliminary Size:635
Sequenced Size:727

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8620 2002-01-01 Sim4 clustering to Release 2
CG8620 2003-01-01 Sim4 clustering to Release 3
CG8620 2008-04-29 Release 5.5 accounting
CG8620 2008-08-15 Release 5.9 accounting
CG8620 2008-12-18 5.12 accounting

Clone Sequence Records

RH55750.complete Sequence

727 bp (727 high quality bases) assembled on 2004-10-04

GenBank Submission: BT021219

> RH55750.complete
GAGTCAAATTCAAGTGTTCAAGTGAAGCAGTCGAAACATAAGCAACAGAT
TCCGCAGCAGTTATATCCAGTTCAGAGAAACAGTAGTTAATCAGTAATTA
AAGTGTTGAGTGAATTTCTTATCGGGTCAGTTGTAAACTAGTGCAAAAAT
GTCGCAATCCGATAACGTGGCACGTGAGCAAACTGCGGCAAATGCAGGGC
CGGATGCATGTCAAGGATGCCGCGGCCAATTGCCAAATGCCACGCCCGTG
GAAGTCGAGGACATGGCCTTGCCGTCGATGGAGCGTCTCATTCGAAAGGC
CAACATGGCCCAGAAAATGCTGAACGATGTGATGAAACAGATCCAGAAGC
AGCAGCAGCAGGAATCTCAACTCTCCATCAAGGAGACCAAGTCCAAGCAC
CGCAGCTCCGATGGAGTTCCAGTTCCGACCACAGTGACTGCGAGCTGATC
CTGGCGGAGAAGGAGGGGCACATGCCGCGGAGAAGACACACGCGAGATGA
CCGCAAGCGGGATCGTTCCCGGTCTCGCGGTCGCTCCCGTGGTCACTCGC
GTGGTCGTTCTCATGGGCGTTCTCGTCCCAGGTCCTACACCGATTCCCGA
CGATCTCGAGCACTACCCCTGGCTCTGCCCGTTCGGATTTCAGTGTGAGT
ATCTGGCTTCATTCAGTATTATTCAATATTCATTTTATATATTAAGTGCG
CATAAAAAAACCAAAAAAAAAAAAAAA

RH55750.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8620-RA 858 CG8620-RA 112..835 2..725 3605 99.8 Plus
CG8620-RB 788 CG8620-RB 1..415 2..416 2075 100 Plus
CG8620-RB 788 CG8620-RB 478..788 415..725 1540 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7150295..7150709 2..416 2045 99.5 Plus
chr3L 24539361 chr3L 7150772..7151069 415..712 1475 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:33:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7158100..7158514 2..416 2075 100 Plus
3L 28110227 3L 7158577..7158887 415..725 1540 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7151200..7151614 2..416 2075 100 Plus
3L 28103327 3L 7151677..7151987 415..725 1540 99.6 Plus
Blast to na_te.dros performed on 2019-03-15 16:46:55 has no hits.

RH55750.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:11 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7150294..7150709 1..416 99 -> Plus
chr3L 7150774..7151060 417..703 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:02 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 1..300 149..448 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:30:52 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 1..300 149..448 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:42 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 1..300 149..448 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:14:45 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 1..300 149..448 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:51 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 1..300 149..448 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:35:25 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 2..712 2..712 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:30:52 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 2..712 2..712 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:42 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 2..712 2..712 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:14:45 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 2..712 2..712 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:51 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
CG8620-RA 2..712 2..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7158099..7158514 1..416 99 -> Plus
3L 7158579..7158874 417..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7158099..7158514 1..416 99 -> Plus
3L 7158579..7158874 417..712 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:11 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7158099..7158514 1..416 99 -> Plus
3L 7158579..7158874 417..712 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:42 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7151679..7151974 417..712 99   Plus
arm_3L 7151199..7151614 1..416 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:51:36 Download gff for RH55750.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7151199..7151614 1..416 99 -> Plus
3L 7151679..7151974 417..712 99   Plus

RH55750.pep Sequence

Translation from 148 to 447

> RH55750.pep
MSQSDNVAREQTAANAGPDACQGCRGQLPNATPVEVEDMALPSMERLIRK
ANMAQKMLNDVMKQIQKQQQQESQLSIKETKSKHRSSDGVPVPTTVTAS*

RH55750.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25013-PA 187 GF25013-PA 1..88 1..89 267 73 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10954-PA 180 GG10954-PA 1..85 1..89 385 86.5 Plus
Dere\GG14409-PA 180 GG14409-PA 1..85 1..89 385 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8620-PA 99 CG8620-PA 1..99 1..99 498 100 Plus
CG8620-PB 187 CG8620-PB 1..89 1..89 449 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25232-PA 183 GL25232-PA 1..90 1..89 206 53.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23734-PA 183 GA23734-PA 1..90 1..89 201 52.1 Plus
Dpse\GA21213-PA 183 GA21213-PA 1..90 1..89 201 52.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14824-PA 186 GM14824-PA 1..89 1..89 361 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:49:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13998-PA 99 GD13998-PA 1..99 1..99 412 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13652-PA 75 GJ13652-PA 1..69 1..69 149 42 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16754-PA 197 GK16754-PA 13..72 10..69 208 65 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:49:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21598-PA 185 GE21598-PA 1..89 1..89 347 86.5 Plus

RH55750.hyp Sequence

Translation from 207 to 647

> RH55750.hyp
MSRMPRPIAKCHARGSRGHGLAVDGASHSKGQHGPENAERCDETDPEAAA
AGISTLHQGDQVQAPQLRWSSSSDHSDCELILAEKEGHMPRRRHTRDDRK
RDRSRSRGRSRGHSRGRSHGRSRSRSYTDSRRSRALPLALPVRISV*

RH55750.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8620-PB 187 CG8620-PB 111..187 70..146 395 100 Plus