Clone RH56103 Report

Search the DGRC for RH56103

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:561
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG6878-RA
Protein status:RH56103.pep: gold
Preliminary Size:512
Sequenced Size:548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6878 2001-12-13 Blastp of sequenced clone
CG6878 2002-01-01 Sim4 clustering to Release 2
CG6878 2003-01-01 Sim4 clustering to Release 3
CG6878 2008-04-29 Release 5.5 accounting
CG6878 2008-08-15 Release 5.9 accounting
CG6878 2008-12-18 5.12 accounting

Clone Sequence Records

RH56103.complete Sequence

548 bp (548 high quality bases) assembled on 2001-12-13

GenBank Submission: AY070706

> RH56103.complete
GTCACACTCACACGTTTACGAATTATTCGACTAGTCGGTGCCGAAATAAA
TAGAAATATTTTGAATATTCCTAAAATAAACGAACCTTCTGCGAGATTCA
TAAGTGCGTCGGAGCAGCGGAGCTTGCTACTCAGCGGTATCAACTCATAT
AGAGCCGGTGAACCAGGAAAACCACGGACTTAGCGGCATGCCTCTGCCTA
CGAGCTCATTTTCCCAGCAGGGACCAACGTGCTTCGATAAGATGAAGACG
GGCTTCATCATCGGATTCTGCGTGGGCATGGCCAGCGGTGCGGTCTTTGG
CGGGTTCTCGGCGCTCAGATACGGACTACGCGGGCGGGAGCTGATCAACA
ACGTGGGCAAGACCATGGTCCAGGGCGGCGGAACCTTTGGCACCTTTATG
GCCATCGGCACGGGGATTCGCTGCTGATCCTGCTGGCATTTGACTAGAGT
TACTAAACAACCACAACCTTAAGCCCTACTCCAATCTTGTTTAAATTACG
CTAAGTTATTGCAATAGAGATGTTACAGAATTAAAAAAAAAAAAAAAA

RH56103.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-RA 697 CG6878-RA 117..648 2..533 2660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15151910..15152226 2..318 1585 100 Plus
chr3L 24539361 chr3L 15152348..15152563 317..532 1065 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15161817..15162133 2..318 1585 100 Plus
3L 28110227 3L 15162255..15162471 317..533 1085 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15154917..15155233 2..318 1585 100 Plus
3L 28103327 3L 15155355..15155571 317..533 1085 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:52:21 has no hits.

RH56103.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:53:06 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15151908..15152226 1..318 99 -> Plus
chr3L 15152350..15152563 319..532 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:06 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..240 188..427 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:54 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..240 188..427 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:37 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..240 188..427 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:05 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..240 188..427 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:40 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..240 188..427 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:00 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..533 1..532 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:54 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..533 1..532 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:37 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..531 2..532 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:05 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..533 1..532 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:40 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
CG6878-RA 1..531 2..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:53:06 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15161815..15162133 1..318 99 -> Plus
3L 15162257..15162470 319..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:53:06 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15161815..15162133 1..318 99 -> Plus
3L 15162257..15162470 319..532 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:53:06 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15161815..15162133 1..318 99 -> Plus
3L 15162257..15162470 319..532 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:37 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15154915..15155233 1..318 99 -> Plus
arm_3L 15155357..15155570 319..532 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:51 Download gff for RH56103.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15154915..15155233 1..318 99 -> Plus
3L 15155357..15155570 319..532 100   Plus

RH56103.pep Sequence

Translation from 187 to 426

> RH56103.pep
MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGR
ELINNVGKTMVQGGGTFGTFMAIGTGIRC*

RH56103.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23691-PA 79 GF23691-PA 1..79 1..79 381 94.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15884-PA 79 GG15884-PA 1..79 1..79 396 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14530-PA 79 GH14530-PA 1..79 1..79 364 89.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-PA 79 CG6878-PA 1..79 1..79 420 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13101-PA 81 GI13101-PA 1..81 1..79 353 88.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24788-PA 79 GL24788-PA 1..79 1..79 378 92.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19926-PA 79 GA19926-PA 1..79 1..79 378 92.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25515-PA 79 GM25515-PA 1..79 1..79 396 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14530-PA 79 GD14530-PA 1..79 1..79 396 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13848-PA 79 GJ13848-PA 1..79 1..79 369 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20403-PA 79 GK20403-PA 1..79 1..79 378 92.4 Plus
Dwil\GK13750-PA 79 GK13750-PA 1..79 1..79 370 91.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22228-PA 79 GE22228-PA 1..79 1..79 396 100 Plus

RH56103.hyp Sequence

Translation from 187 to 426

> RH56103.hyp
MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGR
ELINNVGKTMVQGGGTFGTFMAIGTGIRC*

RH56103.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG6878-PA 79 CG6878-PA 1..79 1..79 420 100 Plus