BDGP Sequence Production Resources |
Search the DGRC for RH56103
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 561 |
Well: | 3 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG6878-RA |
Protein status: | RH56103.pep: gold |
Preliminary Size: | 512 |
Sequenced Size: | 548 |
Gene | Date | Evidence |
---|---|---|
CG6878 | 2001-12-13 | Blastp of sequenced clone |
CG6878 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6878 | 2003-01-01 | Sim4 clustering to Release 3 |
CG6878 | 2008-04-29 | Release 5.5 accounting |
CG6878 | 2008-08-15 | Release 5.9 accounting |
CG6878 | 2008-12-18 | 5.12 accounting |
548 bp (548 high quality bases) assembled on 2001-12-13
GenBank Submission: AY070706
> RH56103.complete GTCACACTCACACGTTTACGAATTATTCGACTAGTCGGTGCCGAAATAAA TAGAAATATTTTGAATATTCCTAAAATAAACGAACCTTCTGCGAGATTCA TAAGTGCGTCGGAGCAGCGGAGCTTGCTACTCAGCGGTATCAACTCATAT AGAGCCGGTGAACCAGGAAAACCACGGACTTAGCGGCATGCCTCTGCCTA CGAGCTCATTTTCCCAGCAGGGACCAACGTGCTTCGATAAGATGAAGACG GGCTTCATCATCGGATTCTGCGTGGGCATGGCCAGCGGTGCGGTCTTTGG CGGGTTCTCGGCGCTCAGATACGGACTACGCGGGCGGGAGCTGATCAACA ACGTGGGCAAGACCATGGTCCAGGGCGGCGGAACCTTTGGCACCTTTATG GCCATCGGCACGGGGATTCGCTGCTGATCCTGCTGGCATTTGACTAGAGT TACTAAACAACCACAACCTTAAGCCCTACTCCAATCTTGTTTAAATTACG CTAAGTTATTGCAATAGAGATGTTACAGAATTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6878-RA | 697 | CG6878-RA | 117..648 | 2..533 | 2660 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15151908..15152226 | 1..318 | 99 | -> | Plus |
chr3L | 15152350..15152563 | 319..532 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..240 | 188..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..240 | 188..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..240 | 188..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..240 | 188..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..240 | 188..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..533 | 1..532 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..533 | 1..532 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..533 | 1..532 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG6878-RA | 1..531 | 2..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15161815..15162133 | 1..318 | 99 | -> | Plus |
3L | 15162257..15162470 | 319..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15161815..15162133 | 1..318 | 99 | -> | Plus |
3L | 15162257..15162470 | 319..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15161815..15162133 | 1..318 | 99 | -> | Plus |
3L | 15162257..15162470 | 319..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15154915..15155233 | 1..318 | 99 | -> | Plus |
arm_3L | 15155357..15155570 | 319..532 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15154915..15155233 | 1..318 | 99 | -> | Plus |
3L | 15155357..15155570 | 319..532 | 100 | Plus |
Translation from 187 to 426
> RH56103.pep MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGR ELINNVGKTMVQGGGTFGTFMAIGTGIRC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23691-PA | 79 | GF23691-PA | 1..79 | 1..79 | 381 | 94.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15884-PA | 79 | GG15884-PA | 1..79 | 1..79 | 396 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14530-PA | 79 | GH14530-PA | 1..79 | 1..79 | 364 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6878-PA | 79 | CG6878-PA | 1..79 | 1..79 | 420 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13101-PA | 81 | GI13101-PA | 1..81 | 1..79 | 353 | 88.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24788-PA | 79 | GL24788-PA | 1..79 | 1..79 | 378 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19926-PA | 79 | GA19926-PA | 1..79 | 1..79 | 378 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25515-PA | 79 | GM25515-PA | 1..79 | 1..79 | 396 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14530-PA | 79 | GD14530-PA | 1..79 | 1..79 | 396 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13848-PA | 79 | GJ13848-PA | 1..79 | 1..79 | 369 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20403-PA | 79 | GK20403-PA | 1..79 | 1..79 | 378 | 92.4 | Plus |
Dwil\GK13750-PA | 79 | GK13750-PA | 1..79 | 1..79 | 370 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22228-PA | 79 | GE22228-PA | 1..79 | 1..79 | 396 | 100 | Plus |
Translation from 187 to 426
> RH56103.hyp MPLPTSSFSQQGPTCFDKMKTGFIIGFCVGMASGAVFGGFSALRYGLRGR ELINNVGKTMVQGGGTFGTFMAIGTGIRC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG6878-PA | 79 | CG6878-PA | 1..79 | 1..79 | 420 | 100 | Plus |