BDGP Sequence Production Resources |
Search the DGRC for RH56317
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 563 |
Well: | 17 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG33169-RA |
Protein status: | RH56317.pep: gold |
Preliminary Size: | 1146 |
Sequenced Size: | 411 |
Gene | Date | Evidence |
---|---|---|
CG8244 | 2002-01-01 | Sim4 clustering to Release 2 |
CG33169 | 2003-01-01 | Sim4 clustering to Release 3 |
CG33169 | 2008-04-29 | Release 5.5 accounting |
CG33169 | 2008-08-15 | Release 5.9 accounting |
CG33169 | 2008-12-18 | 5.12 accounting |
411 bp (411 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071747
> RH56317.complete GAACTTGTTGAACGAAAGAAGGCCAGCTCTCTGTTTTGTTGCTCCACGCA CACACATTCCGACGAGTGTTACACGTCACCAGATTAAAGGAACTATCGCA AAAACTATCAGTGATAAAGATGCGCCAGCTGAAGGGAAAGGTGAAGGAGA CGCGCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCG AAGATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCT GGTGCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCTAATGTA GTCATAAAATGTAGTTTATAGTCGTGGTCAGTGCAATTGAATCGTTGTAA AGACATATAGCCTTAATAGTACAATTAAATCACAGTTCGTCCATCCAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 22852781..22853175 | 2..396 | 1975 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 22863865..22864264 | 2..401 | 2000 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 22856965..22857364 | 2..401 | 2000 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 22852780..22853175 | 1..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RC | 1..177 | 120..296 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RC | 1..177 | 120..296 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 1..177 | 120..296 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RC | 1..177 | 120..296 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 1..177 | 120..296 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 2..396 | 2..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 2..396 | 2..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 2..396 | 2..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 2..396 | 2..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG33169-RA | 2..396 | 2..396 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22863864..22864259 | 1..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22863864..22864259 | 1..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22863864..22864259 | 1..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 22856964..22857359 | 1..396 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22856964..22857359 | 1..396 | 99 | Plus |
Translation from 0 to 300
> RH56317.hyp NLLNERRPALCFVAPRTHIPTSVTRHQIKGTIAKTISDKDAPAEGKGEGD AQTEEGAQAGQPGDPGEDPHRGAAGARRFGGLSGAVRLLEDPPRGLGLM*
Translation from 119 to 295
> RH56317.pep MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL KTRPAVLA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11002-PA | 58 | GF11002-PA | 1..58 | 1..58 | 263 | 93.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16281-PA | 58 | GG16281-PA | 1..58 | 1..58 | 274 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16771-PA | 58 | GH16771-PA | 1..58 | 1..58 | 226 | 74.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG33169-PC | 58 | CG33169-PC | 1..58 | 1..58 | 278 | 100 | Plus |
CG33169-PA | 58 | CG33169-PA | 1..58 | 1..58 | 278 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13432-PA | 58 | GI13432-PA | 1..58 | 1..58 | 229 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24970-PA | 58 | GL24970-PA | 1..58 | 1..58 | 253 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17338-PA | 58 | GA17338-PA | 1..58 | 1..58 | 253 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22474-PA | 58 | GM22474-PA | 1..58 | 1..58 | 277 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15055-PA | 58 | GD15055-PA | 1..58 | 1..58 | 277 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11794-PA | 58 | GJ11794-PA | 1..58 | 1..58 | 233 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19160-PA | 58 | GK19160-PA | 1..58 | 1..58 | 238 | 81 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22643-PA | 58 | GE22643-PA | 1..58 | 1..58 | 269 | 94.8 | Plus |