Clone RH56317 Report

Search the DGRC for RH56317

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:563
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG33169-RA
Protein status:RH56317.pep: gold
Preliminary Size:1146
Sequenced Size:411

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8244 2002-01-01 Sim4 clustering to Release 2
CG33169 2003-01-01 Sim4 clustering to Release 3
CG33169 2008-04-29 Release 5.5 accounting
CG33169 2008-08-15 Release 5.9 accounting
CG33169 2008-12-18 5.12 accounting

Clone Sequence Records

RH56317.complete Sequence

411 bp (411 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071747

> RH56317.complete
GAACTTGTTGAACGAAAGAAGGCCAGCTCTCTGTTTTGTTGCTCCACGCA
CACACATTCCGACGAGTGTTACACGTCACCAGATTAAAGGAACTATCGCA
AAAACTATCAGTGATAAAGATGCGCCAGCTGAAGGGAAAGGTGAAGGAGA
CGCGCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCG
AAGATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCT
GGTGCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCTAATGTA
GTCATAAAATGTAGTTTATAGTCGTGGTCAGTGCAATTGAATCGTTGTAA
AGACATATAGCCTTAATAGTACAATTAAATCACAGTTCGTCCATCCAAAA
AAAAAAAAAAA

RH56317.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-RA 633 CG33169-RA 2..401 2..401 2000 100 Plus
CG33169-RC 396 CG33169-RC 2..396 2..396 1975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22852781..22853175 2..396 1975 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22863865..22864264 2..401 2000 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22856965..22857364 2..401 2000 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:42:48 has no hits.

RH56317.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:43:56 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22852780..22853175 1..396 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:09 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RC 1..177 120..296 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:58:00 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RC 1..177 120..296 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:46:33 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 1..177 120..296 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:44 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RC 1..177 120..296 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:05 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 1..177 120..296 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:50 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 2..396 2..396 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:59 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 2..396 2..396 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:46:33 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 2..396 2..396 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:44 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 2..396 2..396 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:05 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 2..396 2..396 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:56 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22863864..22864259 1..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:56 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22863864..22864259 1..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:43:56 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22863864..22864259 1..396 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:46:33 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22856964..22857359 1..396 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:44 Download gff for RH56317.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22856964..22857359 1..396 99   Plus

RH56317.hyp Sequence

Translation from 0 to 300

> RH56317.hyp
NLLNERRPALCFVAPRTHIPTSVTRHQIKGTIAKTISDKDAPAEGKGEGD
AQTEEGAQAGQPGDPGEDPHRGAAGARRFGGLSGAVRLLEDPPRGLGLM*
Sequence RH56317.hyp has no blast hits.

RH56317.pep Sequence

Translation from 119 to 295

> RH56317.pep
MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL
KTRPAVLA*

RH56317.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11002-PA 58 GF11002-PA 1..58 1..58 263 93.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:48:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16281-PA 58 GG16281-PA 1..58 1..58 274 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16771-PA 58 GH16771-PA 1..58 1..58 226 74.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-PC 58 CG33169-PC 1..58 1..58 278 100 Plus
CG33169-PA 58 CG33169-PA 1..58 1..58 278 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13432-PA 58 GI13432-PA 1..58 1..58 229 79.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24970-PA 58 GL24970-PA 1..58 1..58 253 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17338-PA 58 GA17338-PA 1..58 1..58 253 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:48:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22474-PA 58 GM22474-PA 1..58 1..58 277 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15055-PA 58 GD15055-PA 1..58 1..58 277 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11794-PA 58 GJ11794-PA 1..58 1..58 233 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19160-PA 58 GK19160-PA 1..58 1..58 238 81 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22643-PA 58 GE22643-PA 1..58 1..58 269 94.8 Plus