Clone RH56745 Report

Search the DGRC for RH56745

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:567
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG13065-RA
Protein status:RH56745.pep: gold
Preliminary Size:423
Sequenced Size:694

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13065 2001-12-17 Blastp of sequenced clone
CG13065 2002-01-01 Sim4 clustering to Release 2
CG13065 2003-01-01 Sim4 clustering to Release 3
CG13065 2008-04-29 Release 5.5 accounting
CG13065 2008-08-15 Release 5.9 accounting
CG13065 2008-12-18 5.12 accounting

Clone Sequence Records

RH56745.complete Sequence

694 bp (694 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071748

> RH56745.complete
GCTTATTCAGCTTTGTGTTCTTGCCACGAGTTCAACTTGCAACCAAAACC
AAAATGTTCAAATACTTCGTTTTCGCCGTTTTCTGCCTGGCCAGCGCTGC
TGCTGCTCCTGGCTATTTGGGCGGATTAGCTGCTCCGGCCTTGCCGCTGA
CTGCAGCTGCTCCGGCCATCTCCTATGGACACGCCTTGGCTGCTCCCTCG
ATTGCCTCTTACGGGCTGGCCCCCAGGCTTAGCTATGCCGCCCCGGCCTT
GGCGCACGCTCCTCTGGCTGCTCCGGCCCTTTCCGCCTACGGATTGGGAT
ATGGTCCCGGTCCCATTGGCCTGGCTCATGGTCCTTTGGGACTAGCTCAC
GCCCCTCTGGCCGCTCCCTTGGGATTGGGCTACAAGTCGGCATATCCTAC
TCTGGGTGCTCCTCTGGGACTGGGCTACAAGACAGCTCTTGCTGCTCCTG
CCTATGGACTCGCTCATGGATGGTAAACGAGGTCCATACCACCCATCATC
GTTTTCCGCATGCATTTCGTTTTGTTTGGATCGGTCAGAAATGAGATGTA
AATACACAGAGAAAAAAGAGAGAGAGAGAAATCAGTGAAGGTTTTGTAAA
GTGAAATCAAATTGTTAAAAAACAGATTGTGAAGAGTGGGTTTGATGTTG
AAATATATTTCGATTGAATTTAAAAACTAAAAAAAAAAAAAAAA

RH56745.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13065-RA 755 CG13065-RA 75..753 3..681 3395 100 Plus
CG13065.a 970 CG13065.a 292..970 3..681 3395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16267270..16267890 58..678 3000 98.9 Plus
chr3L 24539361 chr3L 16267146..16267208 3..65 315 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16277560..16278183 58..681 3090 99.7 Plus
3L 28110227 3L 16277436..16277498 3..65 315 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16270660..16271283 58..681 3090 99.6 Plus
3L 28103327 3L 16270536..16270598 3..65 315 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:47:01 has no hits.

RH56745.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:48:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16267143..16267208 1..65 98 -> Plus
chr3L 16267278..16267890 66..678 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..423 54..476 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:33:17 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..423 54..476 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:09:47 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..423 54..476 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:23:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..423 54..476 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:48:56 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..423 54..476 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:23:33 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..679 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:33:17 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..679 1..678 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:09:47 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 2..677 3..678 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:23:15 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 1..679 1..678 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:48:56 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
CG13065-RA 2..677 3..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16277433..16277498 1..65 98 -> Plus
3L 16277568..16278180 66..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16277433..16277498 1..65 98 -> Plus
3L 16277568..16278180 66..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:48:14 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16277433..16277498 1..65 98 -> Plus
3L 16277568..16278180 66..678 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:09:47 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16270533..16270598 1..65 98 -> Plus
arm_3L 16270668..16271280 66..678 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:57:19 Download gff for RH56745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16270668..16271280 66..678 100   Plus
3L 16270533..16270598 1..65 98 -> Plus

RH56745.hyp Sequence

Translation from 0 to 475

> RH56745.hyp
ALFSFVFLPRVQLATKTKMFKYFVFAVFCLASAAAAPGYLGGLAAPALPL
TAAAPAISYGHALAAPSIASYGLAPRLSYAAPALAHAPLAAPALSAYGLG
YGPGPIGLAHGPLGLAHAPLAAPLGLGYKSAYPTLGAPLGLGYKTALAAP
AYGLAHGW*

RH56745.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13065-PA 140 CG13065-PA 1..140 19..158 730 100 Plus

RH56745.pep Sequence

Translation from 53 to 475

> RH56745.pep
MFKYFVFAVFCLASAAAAPGYLGGLAAPALPLTAAAPAISYGHALAAPSI
ASYGLAPRLSYAAPALAHAPLAAPALSAYGLGYGPGPIGLAHGPLGLAHA
PLAAPLGLGYKSAYPTLGAPLGLGYKTALAAPAYGLAHGW*

RH56745.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24173-PA 138 GF24173-PA 1..138 1..140 196 69.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15978-PA 140 GG15978-PA 1..140 1..140 416 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15869-PA 125 GH15869-PA 1..125 1..140 268 55.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13065-PA 140 CG13065-PA 1..140 1..140 730 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12650-PA 198 GI12650-PA 69..198 1..140 178 58.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17845-PA 153 GL17845-PA 1..153 1..140 267 65.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28509-PA 153 GA28509-PA 1..153 1..140 267 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25611-PA 121 GM25611-PA 6..121 25..140 475 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14615-PA 140 GD14615-PA 1..140 1..140 396 95 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12771-PA 133 GJ12771-PA 1..133 1..140 242 66.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19545-PA 144 GE19545-PA 1..144 1..140 328 90.3 Plus