BDGP Sequence Production Resources |
Search the DGRC for RH56745
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 567 |
Well: | 45 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG13065-RA |
Protein status: | RH56745.pep: gold |
Preliminary Size: | 423 |
Sequenced Size: | 694 |
Gene | Date | Evidence |
---|---|---|
CG13065 | 2001-12-17 | Blastp of sequenced clone |
CG13065 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13065 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13065 | 2008-04-29 | Release 5.5 accounting |
CG13065 | 2008-08-15 | Release 5.9 accounting |
CG13065 | 2008-12-18 | 5.12 accounting |
694 bp (694 high quality bases) assembled on 2001-12-17
GenBank Submission: AY071748
> RH56745.complete GCTTATTCAGCTTTGTGTTCTTGCCACGAGTTCAACTTGCAACCAAAACC AAAATGTTCAAATACTTCGTTTTCGCCGTTTTCTGCCTGGCCAGCGCTGC TGCTGCTCCTGGCTATTTGGGCGGATTAGCTGCTCCGGCCTTGCCGCTGA CTGCAGCTGCTCCGGCCATCTCCTATGGACACGCCTTGGCTGCTCCCTCG ATTGCCTCTTACGGGCTGGCCCCCAGGCTTAGCTATGCCGCCCCGGCCTT GGCGCACGCTCCTCTGGCTGCTCCGGCCCTTTCCGCCTACGGATTGGGAT ATGGTCCCGGTCCCATTGGCCTGGCTCATGGTCCTTTGGGACTAGCTCAC GCCCCTCTGGCCGCTCCCTTGGGATTGGGCTACAAGTCGGCATATCCTAC TCTGGGTGCTCCTCTGGGACTGGGCTACAAGACAGCTCTTGCTGCTCCTG CCTATGGACTCGCTCATGGATGGTAAACGAGGTCCATACCACCCATCATC GTTTTCCGCATGCATTTCGTTTTGTTTGGATCGGTCAGAAATGAGATGTA AATACACAGAGAAAAAAGAGAGAGAGAGAAATCAGTGAAGGTTTTGTAAA GTGAAATCAAATTGTTAAAAAACAGATTGTGAAGAGTGGGTTTGATGTTG AAATATATTTCGATTGAATTTAAAAACTAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16267143..16267208 | 1..65 | 98 | -> | Plus |
chr3L | 16267278..16267890 | 66..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..423 | 54..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..423 | 54..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..423 | 54..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..423 | 54..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..423 | 54..476 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..679 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..679 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 2..677 | 3..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 1..679 | 1..678 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13065-RA | 2..677 | 3..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16277433..16277498 | 1..65 | 98 | -> | Plus |
3L | 16277568..16278180 | 66..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16277433..16277498 | 1..65 | 98 | -> | Plus |
3L | 16277568..16278180 | 66..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16277433..16277498 | 1..65 | 98 | -> | Plus |
3L | 16277568..16278180 | 66..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16270533..16270598 | 1..65 | 98 | -> | Plus |
arm_3L | 16270668..16271280 | 66..678 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16270668..16271280 | 66..678 | 100 | Plus | |
3L | 16270533..16270598 | 1..65 | 98 | -> | Plus |
Translation from 0 to 475
> RH56745.hyp ALFSFVFLPRVQLATKTKMFKYFVFAVFCLASAAAAPGYLGGLAAPALPL TAAAPAISYGHALAAPSIASYGLAPRLSYAAPALAHAPLAAPALSAYGLG YGPGPIGLAHGPLGLAHAPLAAPLGLGYKSAYPTLGAPLGLGYKTALAAP AYGLAHGW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13065-PA | 140 | CG13065-PA | 1..140 | 19..158 | 730 | 100 | Plus |
Translation from 53 to 475
> RH56745.pep MFKYFVFAVFCLASAAAAPGYLGGLAAPALPLTAAAPAISYGHALAAPSI ASYGLAPRLSYAAPALAHAPLAAPALSAYGLGYGPGPIGLAHGPLGLAHA PLAAPLGLGYKSAYPTLGAPLGLGYKTALAAPAYGLAHGW*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24173-PA | 138 | GF24173-PA | 1..138 | 1..140 | 196 | 69.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15978-PA | 140 | GG15978-PA | 1..140 | 1..140 | 416 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15869-PA | 125 | GH15869-PA | 1..125 | 1..140 | 268 | 55.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13065-PA | 140 | CG13065-PA | 1..140 | 1..140 | 730 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12650-PA | 198 | GI12650-PA | 69..198 | 1..140 | 178 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17845-PA | 153 | GL17845-PA | 1..153 | 1..140 | 267 | 65.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA28509-PA | 153 | GA28509-PA | 1..153 | 1..140 | 267 | 65.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25611-PA | 121 | GM25611-PA | 6..121 | 25..140 | 475 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14615-PA | 140 | GD14615-PA | 1..140 | 1..140 | 396 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12771-PA | 133 | GJ12771-PA | 1..133 | 1..140 | 242 | 66.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19545-PA | 144 | GE19545-PA | 1..144 | 1..140 | 328 | 90.3 | Plus |