Clone RH56961 Report

Search the DGRC for RH56961

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:569
Well:61
Vector:pFlc-1
Associated Gene/TranscriptCG14482-RA
Protein status:RH56961.pep: gold
Preliminary Size:174
Sequenced Size:311

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14482 2002-01-01 Sim4 clustering to Release 2
CG14482 2003-01-01 Sim4 clustering to Release 3
CG14482 2005-05-03 Blastp of sequenced clone
CG14482 2008-04-29 Release 5.5 accounting
CG14482 2008-08-15 Release 5.9 accounting
CG14482 2008-12-18 5.12 accounting

Clone Sequence Records

RH56961.complete Sequence

311 bp (311 high quality bases) assembled on 2005-05-03

GenBank Submission: BT022080

> RH56961.complete
GATTCATTGCGAACATTTTGGTGCGTGTGAAAAGTTATTAAATCAACAAA
AATGGCTTTCCGCATACCTTTTGGCAAGAAGCACGCTGAGATAGCGAGTT
CCTTCATCCGATCTGGAGCCGGATTCGGAGGAGCTGCTGGCCTGGCCGTG
CTTTACTACACCGACTGGAAGCTGGTCCTACAGTACGTGCCCATCTACGG
ATCCAAGTTCGAAAAAAGCGAGTAACCTTGCCTGCCGTAGTTGAATCCAC
AGTTAGCCTCGATGTTTTGCTTGGTGAATAAAATAAGTTAAAACGAAAAA
AAAAAAAAAAA

RH56961.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14482-RA 411 CG14482-RA 54..347 3..296 1470 100 Plus
CG14482.a 552 CG14482.a 23..316 3..296 1470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13459392..13459582 295..105 955 100 Minus
chr2R 21145070 chr2R 13459711..13459812 104..3 510 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17572332..17572523 296..105 960 100 Minus
2R 25286936 2R 17572652..17572753 104..3 510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17573531..17573722 296..105 960 100 Minus
2R 25260384 2R 17573851..17573952 104..3 510 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:29:45 has no hits.

RH56961.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:30:27 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13459392..13459582 105..295 100 <- Minus
chr2R 13459711..13459813 1..104 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:20 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 1..174 52..225 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:53 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 1..174 52..225 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:31:28 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 1..174 52..225 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:49 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 1..174 52..225 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:41:13 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 1..174 52..225 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:27:04 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 2..294 3..295 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:53 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 2..294 3..295 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:31:28 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 31..324 1..295 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:49 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 2..294 3..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:41:13 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
CG14482-RA 31..324 1..295 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:27 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17572333..17572523 105..295 100 <- Minus
2R 17572652..17572754 1..104 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:27 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17572333..17572523 105..295 100 <- Minus
2R 17572652..17572754 1..104 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:30:27 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17572333..17572523 105..295 100 <- Minus
2R 17572652..17572754 1..104 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:31:28 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13459838..13460028 105..295 100 <- Minus
arm_2R 13460157..13460259 1..104 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:41 Download gff for RH56961.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17573532..17573722 105..295 100 <- Minus
2R 17573851..17573953 1..104 99   Minus

RH56961.pep Sequence

Translation from 51 to 224

> RH56961.pep
MAFRIPFGKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYG
SKFEKSE*

RH56961.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13247-PA 57 GF13247-PA 1..57 1..57 209 89.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21042-PA 57 GG21042-PA 1..57 1..57 290 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20959-PA 57 GH20959-PA 1..57 1..57 206 87.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
UQCR-6.4-PB 57 CG14482-PB 1..57 1..57 296 100 Plus
UQCR-6.4-PA 57 CG14482-PA 1..57 1..57 296 100 Plus
CG43206-PA 72 CG43206-PA 18..66 9..57 130 49 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21296-PA 57 GI21296-PA 1..57 1..57 209 91.2 Plus
Dmoj\GI16549-PA 64 GI16549-PA 14..60 9..55 136 46.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10620-PA 57 GL10620-PA 1..57 1..57 204 91.2 Plus
Dper\GL14819-PA 71 GL14819-PA 17..66 8..57 133 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13018-PA 57 GA13018-PA 1..57 1..57 204 91.2 Plus
Dpse\GA26229-PA 71 GA26229-PA 17..66 8..57 133 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19970-PA 57 GM19970-PA 1..57 1..57 290 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25464-PA 57 GD25464-PA 1..57 1..57 290 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20898-PA 57 GJ20898-PA 1..57 1..57 202 89.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21400-PA 57 GK21400-PA 1..57 1..57 210 89.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13985-PA 57 GE13985-PA 1..57 1..57 290 100 Plus

RH56961.hyp Sequence

Translation from 51 to 224

> RH56961.hyp
MAFRIPFGKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYG
SKFEKSE*

RH56961.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14482-PB 57 CG14482-PB 1..57 1..57 296 100 Plus
CG14482-PA 57 CG14482-PA 1..57 1..57 296 100 Plus
CG43206-PA 72 CG43206-PA 18..66 9..57 130 49 Plus