Clone RH57257 Report

Search the DGRC for RH57257

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:572
Well:57
Vector:pFlc-1
Associated Gene/TranscriptCG7322-RA
Protein status:RH57257.pep: gold
Preliminary Size:729
Sequenced Size:896

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7322 2002-01-01 Sim4 clustering to Release 2
CG7322 2003-01-01 Sim4 clustering to Release 3
CG7322 2003-02-24 Blastp of sequenced clone
CG7322 2008-04-29 Release 5.5 accounting
CG7322 2008-08-15 Release 5.9 accounting
CG7322 2008-12-18 5.12 accounting

Clone Sequence Records

RH57257.complete Sequence

896 bp (896 high quality bases) assembled on 2003-02-24

GenBank Submission: BT004833

> RH57257.complete
GGTATTTCCAGTTCAGTTCGCCCAGCGATCCTCTTGCATTCGGAACGGAA
CTTTCCAAGATTAAGCAGCTTTCATTATGTGGACAGATCTCGCGGGCAAG
GTGATCTTGGTGACCGGAGCCGGGGCCGGTATTGGCCAGGCGTTGGTCAA
GCAGTTGGCCTCCGCGGGTGCCACCGTCATCGCAGTGGCCAGGAAGCCAG
AGCAGCTCCAGCAGCTGGTGGCCTTCGATCCGGTGCACATCCAGCCGCTG
CAATTGGATCTCAGCGGCTGGCAGGCGGTGCGTGAGGGGCTGGCGAAGGT
GCCTCTGCTGGACGGTCTGGTCAACAACGCCGGCGTGGCCATCATCAAGC
CATTCGAGGAGCTCACCGAACAGGATTTCGACACCCACTTCGATGTGAAC
ATCAAGGCGGTGTTCAATGTCACCCAATCTCTGCTGCCCCGCTTGAAAGA
CGGAGCCTCAATTGTCAACGTGTCCTCGATAGCGTCATCCCGATCCTTTG
GCGGCCACACGGCCTACAGTGCCACCAAGGCGGCCCTCGATTCGCTGACC
AAGTCGCTGGCCTTGGAGCTGGGTCCGCGCAAAATTCGCGTCAATTCCGT
TAATCCCACCGTGGTGCTGACCAAAATGGGCGCCGACAATTGGTCGGATC
CCGCCAAGAGTGGACCGCTGCTGGCCCACATACCGCTGAATCGGTTCTGC
GAGGTGCAGGAGGTGGTGGACGCCACCGGCTATCTGCTGAGCAGCAAGTC
GAGCTTCGTGAACGGCCACCACATCCTGCTCGAAGGTGGATATTCCGTTT
CCTAAGACGCCAGCGTTAACTTCAATGTGCAAGCCCGAAATTTGATACAA
ATGAAATATGATTGAATTAAAACTGTGGAAAAAAAAAAAAAAAAAA

RH57257.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG7322-RA 1083 CG7322-RA 154..1033 2..881 4400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18745085..18745582 878..381 2460 99.6 Minus
chrX 22417052 chrX 18746213..18746595 384..2 1855 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18855937..18856437 881..381 2490 99.8 Minus
X 23542271 X 18857069..18857451 384..2 1915 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18864035..18864535 881..381 2490 99.8 Minus
X 23527363 X 18865167..18865549 384..2 1915 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:40:12 has no hits.

RH57257.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:41:15 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18745085..18745578 385..878 99 <- Minus
chrX 18746213..18746595 1..384 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:24 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..729 77..805 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:44:22 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..729 77..805 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:09:58 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..729 77..805 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:35:47 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..729 77..805 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:49 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..729 77..805 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:54:59 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..877 2..878 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:44:22 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..877 2..878 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:09:58 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RB 1..877 2..878 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:35:47 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RA 1..877 2..878 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:49 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
CG7322-RB 1..877 2..878 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:15 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
X 18855940..18856433 385..878 100 <- Minus
X 18857069..18857451 1..384 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:15 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
X 18855940..18856433 385..878 100 <- Minus
X 18857069..18857451 1..384 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:15 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
X 18855940..18856433 385..878 100 <- Minus
X 18857069..18857451 1..384 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:09:58 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18749973..18750466 385..878 100 <- Minus
arm_X 18751102..18751484 1..384 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:05:49 Download gff for RH57257.complete
Subject Subject Range Query Range Percent Splice Strand
X 18864038..18864531 385..878 100 <- Minus
X 18865167..18865549 1..384 99   Minus

RH57257.pep Sequence

Translation from 76 to 804

> RH57257.pep
MWTDLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAF
DPVHIQPLQLDLSGWQAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQD
FDTHFDVNIKAVFNVTQSLLPRLKDGASIVNVSSIASSRSFGGHTAYSAT
KAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPAKSGPLLA
HIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGYSVS*

RH57257.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19246-PA 242 GF19246-PA 1..242 1..242 1140 90.1 Plus
Dana\GF22046-PA 251 GF22046-PA 3..244 5..238 322 36.5 Plus
Dana\GF16339-PA 257 GF16339-PA 7..250 8..238 315 35.2 Plus
Dana\GF16338-PA 257 GF16338-PA 7..250 8..238 314 34.8 Plus
Dana\GF18656-PA 256 GF18656-PA 2..249 4..238 305 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18088-PA 242 GG18088-PA 1..242 1..242 1229 97.5 Plus
Dere\GG12728-PA 251 GG12728-PA 3..244 5..238 333 36 Plus
Dere\GG12970-PA 257 GG12970-PA 7..250 8..238 318 35.7 Plus
Dere\GG12965-PA 257 GG12965-PA 7..250 8..238 316 35.2 Plus
Dere\GG10914-PA 256 GG10914-PA 2..249 4..238 293 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17658-PA 242 GH17658-PA 1..242 1..242 1058 83.1 Plus
Dgri\GH22973-PA 257 GH22973-PA 7..250 8..238 339 38.4 Plus
Dgri\GH22984-PA 257 GH22984-PA 7..253 8..241 298 34.8 Plus
Dgri\GH12482-PA 248 GH12482-PA 6..246 5..238 296 34.3 Plus
Dgri\GH15276-PA 325 GH15276-PA 77..322 5..240 289 32.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7322-PC 242 CG7322-PC 1..242 1..242 1214 100 Plus
CG7322-PB 242 CG7322-PB 1..242 1..242 1214 100 Plus
CG7322-PA 242 CG7322-PA 1..242 1..242 1214 100 Plus
CG3699-PA 251 CG3699-PA 3..244 5..238 339 37.2 Plus
CG31549-PB 257 CG31549-PB 7..250 8..238 326 35.7 Plus
CG31549-PA 257 CG31549-PA 7..250 8..238 326 35.7 Plus
CG12171-PA 257 CG12171-PA 7..250 8..238 320 35.7 Plus
CG31548-PA 256 CG31548-PA 2..249 4..238 295 32.7 Plus
CG31546-PA 264 CG31546-PA 10..260 4..241 295 33.9 Plus
CG3603-PB 249 CG3603-PB 6..247 5..238 290 35.4 Plus
CG3603-PA 249 CG3603-PA 6..247 5..238 290 35.4 Plus
CG10672-PA 317 CG10672-PA 69..312 5..238 284 33.1 Plus
CG10425-PA 336 CG10425-PA 33..219 5..177 195 31.6 Plus
CG2064-PA 330 CG2064-PA 39..246 3..190 187 31.3 Plus
CG7601-PA 326 CG7601-PA 51..243 5..184 184 30.4 Plus
CG2065-PB 300 CG2065-PB 10..216 3..189 178 32.4 Plus
CG2065-PA 300 CG2065-PA 10..216 3..189 178 32.4 Plus
CG30491-PB 331 CG30491-PB 41..243 3..184 177 31.2 Plus
CG30491-PA 331 CG30491-PA 41..243 3..184 177 31.2 Plus
CG31809-PC 316 CG31809-PC 48..248 7..199 171 31.4 Plus
CG31809-PB 316 CG31809-PB 48..248 7..199 171 31.4 Plus
CG31810-PA 324 CG31810-PA 56..256 7..199 171 31.4 Plus
CG6012-PA 308 CG6012-PA 54..250 12..199 169 28.5 Plus
CG2070-PB 325 CG2070-PB 39..241 3..184 168 32.2 Plus
CG2070-PA 325 CG2070-PA 39..241 3..184 168 32.2 Plus
sni-PB 247 CG10964-PB 4..210 10..188 166 30.4 Plus
sni-PA 247 CG10964-PA 4..210 10..188 166 30.4 Plus
firl-PE 318 CG14946-PE 52..244 4..182 160 27.5 Plus
firl-PC 318 CG14946-PC 52..244 4..182 160 27.5 Plus
firl-PD 318 CG14946-PD 52..244 4..182 160 27.5 Plus
CG30495-PA 327 CG30495-PA 41..243 3..184 160 30.2 Plus
CG30495-PB 331 CG30495-PB 41..243 3..184 160 30.2 Plus
CG11200-PC 355 CG11200-PC 68..272 8..184 158 29.5 Plus
CG11200-PA 355 CG11200-PA 68..272 8..184 158 29.5 Plus
CG11200-PB 355 CG11200-PB 68..272 8..184 158 29.5 Plus
CG13284-PE 325 CG13284-PE 53..256 4..198 155 28.4 Plus
CG13284-PA 325 CG13284-PA 53..256 4..198 155 28.4 Plus
CG13284-PC 338 CG13284-PC 66..269 4..198 155 28.4 Plus
CG13284-PD 339 CG13284-PD 67..270 4..198 155 28.4 Plus
CG13284-PB 339 CG13284-PB 67..270 4..198 155 28.4 Plus
CG40485-PC 247 CG40485-PC 8..229 9..223 147 27.3 Plus
CG40485-PB 247 CG40485-PB 8..229 9..223 147 27.3 Plus
CG9360-PA 251 CG9360-PA 7..203 8..184 146 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21510-PA 242 GI21510-PA 1..242 1..242 1057 84.7 Plus
Dmoj\GI14997-PA 255 GI14997-PA 3..248 5..238 321 35.2 Plus
Dmoj\GI10241-PA 257 GI10241-PA 7..250 8..238 315 34.4 Plus
Dmoj\GI11985-PA 329 GI11985-PA 81..326 5..240 293 33.2 Plus
Dmoj\GI22521-PA 256 GI22521-PA 2..249 4..238 290 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21318-PA 350 GL21318-PA 109..350 1..242 1135 88.8 Plus
Dper\GL24510-PA 257 GL24510-PA 6..250 7..238 327 35.5 Plus
Dper\GL24511-PA 257 GL24511-PA 7..250 8..238 315 35.7 Plus
Dper\GL14417-PA 255 GL14417-PA 3..248 5..238 314 35.4 Plus
Dper\GL23021-PA 256 GL23021-PA 2..249 4..238 313 34.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20258-PA 242 GA20258-PA 1..242 1..242 1133 88.8 Plus
Dpse\GA27306-PA 257 GA27306-PA 6..250 7..238 331 35.9 Plus
Dpse\GA16317-PA 256 GA16317-PA 2..249 4..238 316 34.7 Plus
Dpse\GA17622-PA 255 GA17622-PA 3..248 5..238 314 35.4 Plus
Dpse\GA11451-PA 257 GA11451-PA 7..250 8..238 311 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22780-PA 242 GM22780-PA 1..242 1..242 1250 99.6 Plus
Dsec\GM19006-PA 251 GM19006-PA 3..244 5..238 333 36.4 Plus
Dsec\GM10825-PA 257 GM10825-PA 7..250 8..238 323 35.7 Plus
Dsec\GM10826-PA 257 GM10826-PA 7..250 8..238 314 35.7 Plus
Dsec\GM10606-PA 256 GM10606-PA 2..249 4..238 296 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24467-PA 242 GD24467-PA 1..242 1..242 1256 99.6 Plus
Dsim\GD16445-PA 251 GD16445-PA 3..244 5..238 333 36.4 Plus
Dsim\GD19803-PA 257 GD19803-PA 7..250 8..238 309 35.2 Plus
Dsim\GD19595-PA 256 GD19595-PA 2..249 4..238 296 33.5 Plus
Dsim\GD16628-PA 249 GD16628-PA 6..247 5..238 271 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19048-PA 242 GJ19048-PA 1..242 1..242 1064 84.3 Plus
Dvir\GJ11045-PA 257 GJ11045-PA 7..250 8..238 324 36.3 Plus
Dvir\GJ10124-PA 255 GJ10124-PA 2..248 4..238 306 33.2 Plus
Dvir\GJ15354-PA 255 GJ15354-PA 3..248 5..238 300 35.6 Plus
Dvir\GJ10125-PA 255 GJ10125-PA 2..248 4..238 287 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20088-PA 242 GK20088-PA 1..242 1..242 1069 83.1 Plus
Dwil\GK10169-PA 255 GK10169-PA 3..248 5..238 338 36.3 Plus
Dwil\GK13928-PA 257 GK13928-PA 7..250 8..238 318 35.2 Plus
Dwil\GK13927-PA 257 GK13927-PA 7..250 8..238 311 35 Plus
Dwil\GK20583-PA 295 GK20583-PA 63..292 5..240 290 33.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15485-PA 242 GE15485-PA 1..242 1..242 1245 98.8 Plus
Dyak\GE16554-PA 251 GE16554-PA 3..244 5..238 324 36 Plus
Dyak\GE10146-PA 257 GE10146-PA 7..250 8..238 321 34.8 Plus
Dyak\GE10147-PA 257 GE10147-PA 7..250 8..238 309 35.6 Plus
Dyak\GE24152-PA 256 GE24152-PA 2..249 4..238 299 34.1 Plus

RH57257.hyp Sequence

Translation from 76 to 804

> RH57257.hyp
MWTDLAGKVILVTGAGAGIGQALVKQLASAGATVIAVARKPEQLQQLVAF
DPVHIQPLQLDLSGWQAVREGLAKVPLLDGLVNNAGVAIIKPFEELTEQD
FDTHFDVNIKAVFNVTQSLLPRLKDGASIVNVSSIASSRSFGGHTAYSAT
KAALDSLTKSLALELGPRKIRVNSVNPTVVLTKMGADNWSDPAKSGPLLA
HIPLNRFCEVQEVVDATGYLLSSKSSFVNGHHILLEGGYSVS*

RH57257.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7322-PC 242 CG7322-PC 1..242 1..242 1214 100 Plus
CG7322-PB 242 CG7322-PB 1..242 1..242 1214 100 Plus
CG7322-PA 242 CG7322-PA 1..242 1..242 1214 100 Plus
CG3699-PA 251 CG3699-PA 3..244 5..238 339 37.2 Plus
CG31549-PB 257 CG31549-PB 7..250 8..238 326 35.7 Plus