Clone RH57268 Report

Search the DGRC for RH57268

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:572
Well:68
Vector:pFlc-1
Associated Gene/TranscriptCG5934-RA
Protein status:RH57268.pep: gold
Preliminary Size:512
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5934 2002-01-01 Sim4 clustering to Release 2
CG5934 2002-02-22 Blastp of sequenced clone
CG5934 2003-01-01 Sim4 clustering to Release 3
CG5934 2008-04-29 Release 5.5 accounting
CG5934 2008-08-15 Release 5.9 accounting
CG5934 2008-12-18 5.12 accounting

Clone Sequence Records

RH57268.complete Sequence

800 bp (800 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084197

> RH57268.complete
GAGCTAGTGTTGGCCAACTTCCCAAAGGGTAGTTTTATTTTCGTGTCAAT
TGTTAAGAGAAATTTGGCAAAAGTGAATAGAGTTTAAGTTTTATAGAATA
AAGAGTACCCCTGAACACTGCCAGCCATGTCCCTGTTAAACAATGACGAC
AGCATTCCCAACATGGACGAGGATCCACAGGTGGTCATTCCGGACGACGA
GCCACCGGCGACGGGACGAATGCCCAGTGGGAGGTCCATGGACTCGTTGC
GTTCATCGTTCACCAACCGCAGTTCCACGCCAGATTCATCGCACAATTCG
CTGGAGGCCATGGAAATGGCCCAGGACGATCGGGAGGAGAAGGCCCGCCT
CATCACACAGGTCCTGGAGCTGCAGAACACCCTGGACGACCTGTCGCAAC
GCGTCGATTCCGTCAAGGAGGAAAATCTGAAGCTGCGCTCCGAGAACCAG
GTGCTCGGCCAGTACATCGAGAACCTGATGTCGGCCTCATCGGTGTTCCA
GTCCACCAGTCCCAGTGCGGCCAAAAAGAAGTAATCTTCTATAGTCAATC
GACCCACCGGTACTGGAAACCAAAAACCTTCTCAAATATGCCTTCTCGTT
CACGCTAGAGCTACATGTATATTTTAATCTGTAACACTCGAAATTAAGCT
ATTGCAATGTTATTTCAGTTGCCCGATTGTCGAATTTGTATTTGTTTAGG
CTTAAGCTTATGGCGCGCTATGTATTTTATACATAGAAGTAATTAATTTA
TATAGATAATTAATAAATCAATAATACCCCACGCAAAAAAAAAAAAAAAA

RH57268.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5934-RA 875 CG5934-RA 65..849 2..786 3925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23096893..23097496 181..784 3005 99.8 Plus
chr3R 27901430 chr3R 23096637..23096816 2..181 900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27273962..27274567 181..786 3030 100 Plus
3R 32079331 3R 27273706..27273885 2..181 900 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27014793..27015398 181..786 3030 100 Plus
3R 31820162 3R 27014537..27014716 2..181 900 100 Plus
Blast to na_te.dros performed 2019-03-16 20:04:23
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 4531..4580 725..776 111 71.2 Plus

RH57268.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:05:28 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23096635..23096816 1..181 99 -> Plus
chr3R 23096894..23097451 182..739 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:24 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..408 127..534 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:36:40 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..408 127..534 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:38:40 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..408 127..534 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:07:51 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..408 127..534 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:51:24 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..408 127..534 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:02:05 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:36:40 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:38:40 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 2..784 2..784 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:07:51 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:24 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
CG5934-RA 2..784 2..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:28 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27273704..27273885 1..181 99 -> Plus
3R 27273963..27274565 182..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:28 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27273704..27273885 1..181 99 -> Plus
3R 27273963..27274565 182..784 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:05:28 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27273704..27273885 1..181 99 -> Plus
3R 27273963..27274565 182..784 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:38:40 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23099426..23099607 1..181 99 -> Plus
arm_3R 23099685..23100287 182..784 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:41:52 Download gff for RH57268.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27014794..27015396 182..784 100   Plus
3R 27014535..27014716 1..181 99 -> Plus

RH57268.pep Sequence

Translation from 126 to 533

> RH57268.pep
MSLLNNDDSIPNMDEDPQVVIPDDEPPATGRMPSGRSMDSLRSSFTNRSS
TPDSSHNSLEAMEMAQDDREEKARLITQVLELQNTLDDLSQRVDSVKEEN
LKLRSENQVLGQYIENLMSASSVFQSTSPSAAKKK*

RH57268.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16281-PA 135 GF16281-PA 1..135 1..135 634 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11541-PA 135 GG11541-PA 1..135 1..135 689 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19516-PA 135 GH19516-PA 1..135 1..135 542 78.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5934-PA 135 CG5934-PA 1..135 1..135 671 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22257-PA 135 GI22257-PA 1..135 1..135 552 80 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24486-PA 135 GL24486-PA 1..135 1..135 591 87.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19242-PA 135 GA19242-PA 1..135 1..135 594 87.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10383-PA 135 GM10383-PA 1..135 1..135 689 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15135-PA 135 GD15135-PA 1..135 1..135 689 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24048-PA 135 GJ24048-PA 1..135 1..135 548 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22576-PA 136 GK22576-PA 1..136 1..135 578 85.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23729-PA 135 GE23729-PA 1..135 1..135 689 100 Plus

RH57268.hyp Sequence

Translation from 126 to 533

> RH57268.hyp
MSLLNNDDSIPNMDEDPQVVIPDDEPPATGRMPSGRSMDSLRSSFTNRSS
TPDSSHNSLEAMEMAQDDREEKARLITQVLELQNTLDDLSQRVDSVKEEN
LKLRSENQVLGQYIENLMSASSVFQSTSPSAAKKK*

RH57268.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG5934-PA 135 CG5934-PA 1..135 1..135 671 100 Plus