Clone RH57745 Report

Search the DGRC for RH57745

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:577
Well:45
Vector:pFlc-1
Associated Gene/TranscriptmRpL21-RA
Protein status:RH57745.pep: gold
Preliminary Size:591
Sequenced Size:754

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9730 2002-01-01 Sim4 clustering to Release 2

Clone Sequence Records

RH57745.complete Sequence

754 bp assembled on 2011-07-21

GenBank Submission: BT128761.1

> RH57745.complete
ATTCACATTTTGCCTATCTGCCGACATTAAACCGATCCGATTTATTTATG
TACTTTTGAGTTAAAAACAAAGCCAAACGATGTCCTTTCTAGCGCAAACT
ATGCGTCAAATGCTACGCCACGTGCCCAATCGCAGTTTGTTGACGGCAGG
TGCCATGCGTCCACTGAGCATATCGCCGGTAATTGGGCAGCAAAACAAGC
CGGCGACGGAATCGGTGGATTTATCGGCCATAGCTAAGGATCAGCAGAAG
GAGTGCCTGAGCATCTGCGAGCGCATCAACCGGCAGGTGCAAAAATCCGA
GCAGGGACGACTCTTCGCGGTTGTCCACCTGTGCGGCAAGCAATTTAAAG
TAACTCCAGGAGATATCATCCTGGTGGAGGGATACTGGCCGCCAACGATA
GGCGACGAGATCAGCCTGGATAAGGTGCTCCTGGCCGGTGCCCGCGACTT
CACGCTCGTGGGAAGGCCCATTTTGGAGCCCGGACTCATCTTGGTGAAGG
CCACCGTCGTGGAGAAGACGCTCAGCCACACGAAGACGCACTTTAGGAAG
AAGCGCAGGAAGCAGTACATGCGCATCAACTTCCAGAGATCTCCGCACAC
CATGGTCCGGATCAATTCAATTGAACTGGCTCGTCCAGTGGACGGGAATG
GCGAGGGGGAGTCTTCCTCGAGGCGCTTGTTTTAGTTTAAAATGCTGTTG
ATCACGAAAAATAAACCAAGTTTTTGGAAGGTAATTAAGAAAAAAAAAAA
AAAA

RH57745.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19243707..19244298 739..148 2960 100 Minus
chr3L 24539361 chr3L 19244371..19244521 151..1 755 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19254240..19254835 743..148 2980 100 Minus
3L 28110227 3L 19254908..19255058 151..1 755 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19247340..19247935 743..148 2980 100 Minus
3L 28103327 3L 19248008..19248158 151..1 755 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:47:39 has no hits.

RH57745.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:48:22 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19243707..19244296 150..739 100 <- Minus
chr3L 19244373..19244521 1..149 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-21 16:02:32 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 1..606 80..685 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:25:58 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 1..606 80..685 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:12:39 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 1..606 80..685 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-21 16:02:32 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 1..738 2..739 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:25:58 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 4..742 1..739 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:12:39 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL21-RA 4..742 1..739 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:22 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19254244..19254833 150..739 100 <- Minus
3L 19254910..19255058 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:22 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19254244..19254833 150..739 100 <- Minus
3L 19254910..19255058 1..149 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:48:22 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19254244..19254833 150..739 100 <- Minus
3L 19254910..19255058 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:25:58 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19247344..19247933 150..739 100 <- Minus
arm_3L 19248010..19248158 1..149 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:27 Download gff for RH57745.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19247344..19247933 150..739 100 <- Minus
3L 19248010..19248158 1..149 100   Minus

RH57745.pep Sequence

Translation from 79 to 684

> RH57745.pep
MSFLAQTMRQMLRHVPNRSLLTAGAMRPLSISPVIGQQNKPATESVDLSA
IAKDQQKECLSICERINRQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVE
GYWPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKTLSH
TKTHFRKKRRKQYMRINFQRSPHTMVRINSIELARPVDGNGEGESSSRRL
F*

RH57745.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10776-PA 202 GF10776-PA 1..202 1..201 899 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13419-PA 201 GG13419-PA 1..201 1..201 1023 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16735-PA 199 GH16735-PA 1..199 1..201 815 74.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL21-PB 201 CG9730-PB 1..201 1..201 1022 100 Plus
mRpL21-PC 201 CG9730-PC 1..201 1..201 1022 100 Plus
mRpL21-PA 201 CG9730-PA 1..201 1..201 1022 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13461-PA 199 GI13461-PA 1..199 1..201 836 76.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:12:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20915-PA 204 GL20915-PA 1..204 1..201 817 77.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21992-PA 204 GA21992-PA 1..204 1..201 814 76.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14887-PA 201 GM14887-PA 1..201 1..201 1047 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12295-PA 114 GD12295-PA 1..97 1..97 450 88.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:12:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11824-PA 201 GJ11824-PA 1..201 1..201 838 75.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:12:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12457-PA 208 GK12457-PA 1..208 1..201 776 72.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:12:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22516-PA 201 GE22516-PA 1..201 1..201 1026 96 Plus
Dyak\GE22920-PA 201 GE22920-PA 1..201 1..201 1018 95.5 Plus

RH57745.hyp Sequence

Translation from 79 to 684

> RH57745.hyp
MSFLAQTMRQMLRHVPNRSLLTAGAMRPLSISPVIGQQNKPATESVDLSA
IAKDQQKECLSICERINRQVQKSEQGRLFAVVHLCGKQFKVTPGDIILVE
GYWPPTIGDEISLDKVLLAGARDFTLVGRPILEPGLILVKATVVEKTLSH
TKTHFRKKRRKQYMRINFQRSPHTMVRINSIELARPVDGNGEGESSSRRL
F*

RH57745.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL21-PB 201 CG9730-PB 1..201 1..201 1022 100 Plus
mRpL21-PC 201 CG9730-PC 1..201 1..201 1022 100 Plus
mRpL21-PA 201 CG9730-PA 1..201 1..201 1022 100 Plus