Clone RH57845 Report

Search the DGRC for RH57845

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:578
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG15704-RA
Protein status:RH57845.pep: gold
Preliminary Size:156
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15704 2002-01-01 Sim4 clustering to Release 2
CG15704 2002-04-26 Blastp of sequenced clone
CG15704 2003-01-01 Sim4 clustering to Release 3
CG15704 2008-04-29 Release 5.5 accounting
CG15704 2008-08-15 Release 5.9 accounting
CG15704 2008-12-18 5.12 accounting

Clone Sequence Records

RH57845.complete Sequence

471 bp (471 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113605

> RH57845.complete
GATCATTTGAAGAAAAGAGTTGGTCGCCTGTGAACACGGTGAACTTAAGC
ATTAGAGGTTTAAGCTTATCAGGATATAGGAGTGCACCCAGCTTACACAT
CGATAGATAGCTCAGCTGAGCGCGAAAGTAACTGGAATAAGTAAGGGAAT
CACTGGTCTAGCGAAGCACCCAGCCACGGATGTGTCTGTACTTGGGAGTG
GTGGAGCACCTGGTGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGA
GCTGTCCCTGTTCGCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGC
TGACCCACGGACCCACCAACGAGCTGGAGCAATGACCAGGACACCAGGAG
TGCTGCTAAAAGGATGCGCGCGTTTGTGTGTTTGAGTGTGTTTCGACTAA
AATTTAATAAAGGCAACTTTTCTAGTGGCGAATAAATTACAACTCATATG
TGCTTGTAAAAAAAAAAAAAA

RH57845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-RA 457 CG15704-RA 2..457 2..457 2280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:19:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12167368..12167823 2..457 2280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16280015..16280473 2..460 2295 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16281214..16281672 2..460 2295 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:19:45 has no hits.

RH57845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:20:41 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12167367..12167823 1..457 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:36 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..156 180..335 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:05 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..156 180..335 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:17:37 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..156 180..335 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:53 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..156 180..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:17:03 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..156 180..335 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:25 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 2..457 2..457 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:05 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 2..457 2..457 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:17:37 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..456 2..457 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:53 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 2..457 2..457 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:17:03 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
CG15704-RA 1..456 2..457 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:41 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280014..16280470 1..457 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:41 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280014..16280470 1..457 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:20:41 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280014..16280470 1..457 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:17:37 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12167519..12167975 1..457 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:15 Download gff for RH57845.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16281213..16281669 1..457 99   Plus

RH57845.pep Sequence

Translation from 179 to 334

> RH57845.pep
MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE
Q*

RH57845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13584-PA 51 GF13584-PA 1..51 1..51 231 86.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20588-PA 51 GG20588-PA 1..51 1..51 253 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22108-PA 52 GH22108-PA 1..44 1..44 143 56.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
prim-PA 51 CG15704-PA 1..51 1..51 273 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19244-PA 58 GI19244-PA 1..41 1..41 147 70.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10722-PA 52 GL10722-PA 1..51 1..51 129 41.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24457-PA 52 GA24457-PA 1..51 1..51 129 41.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21678-PA 51 GM21678-PA 1..51 1..51 254 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11179-PA 51 GD11179-PA 1..51 1..51 257 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:57:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20321-PA 56 GJ20321-PA 1..50 1..50 169 66 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19313-PA 48 GK19313-PA 1..41 1..41 160 75.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11773-PA 51 GE11773-PA 1..51 1..51 257 98 Plus

RH57845.hyp Sequence

Translation from 179 to 334

> RH57845.hyp
MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE
Q*

RH57845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15704-PA 51 CG15704-PA 1..51 1..51 273 100 Plus