BDGP Sequence Production Resources |
Search the DGRC for RH57845
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 578 |
Well: | 45 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG15704-RA |
Protein status: | RH57845.pep: gold |
Preliminary Size: | 156 |
Sequenced Size: | 471 |
Gene | Date | Evidence |
---|---|---|
CG15704 | 2002-01-01 | Sim4 clustering to Release 2 |
CG15704 | 2002-04-26 | Blastp of sequenced clone |
CG15704 | 2003-01-01 | Sim4 clustering to Release 3 |
CG15704 | 2008-04-29 | Release 5.5 accounting |
CG15704 | 2008-08-15 | Release 5.9 accounting |
CG15704 | 2008-12-18 | 5.12 accounting |
471 bp (471 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113605
> RH57845.complete GATCATTTGAAGAAAAGAGTTGGTCGCCTGTGAACACGGTGAACTTAAGC ATTAGAGGTTTAAGCTTATCAGGATATAGGAGTGCACCCAGCTTACACAT CGATAGATAGCTCAGCTGAGCGCGAAAGTAACTGGAATAAGTAAGGGAAT CACTGGTCTAGCGAAGCACCCAGCCACGGATGTGTCTGTACTTGGGAGTG GTGGAGCACCTGGTGGATGTGGTGGCCTACTGCATGTGCCGTGTCCTGGA GCTGTCCCTGTTCGCCTGCATGATGGTCTGCGGCTCCATGAGAGCCAAGC TGACCCACGGACCCACCAACGAGCTGGAGCAATGACCAGGACACCAGGAG TGCTGCTAAAAGGATGCGCGCGTTTGTGTGTTTGAGTGTGTTTCGACTAA AATTTAATAAAGGCAACTTTTCTAGTGGCGAATAAATTACAACTCATATG TGCTTGTAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15704-RA | 457 | CG15704-RA | 2..457 | 2..457 | 2280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 12167368..12167823 | 2..457 | 2280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 16280015..16280473 | 2..460 | 2295 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 16281214..16281672 | 2..460 | 2295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12167367..12167823 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..156 | 180..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..156 | 180..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..156 | 180..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..156 | 180..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..156 | 180..335 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 2..457 | 2..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 2..457 | 2..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..456 | 2..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 2..457 | 2..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15704-RA | 1..456 | 2..457 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280014..16280470 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280014..16280470 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280014..16280470 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12167519..12167975 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16281213..16281669 | 1..457 | 99 | Plus |
Translation from 179 to 334
> RH57845.pep MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13584-PA | 51 | GF13584-PA | 1..51 | 1..51 | 231 | 86.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20588-PA | 51 | GG20588-PA | 1..51 | 1..51 | 253 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22108-PA | 52 | GH22108-PA | 1..44 | 1..44 | 143 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
prim-PA | 51 | CG15704-PA | 1..51 | 1..51 | 273 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19244-PA | 58 | GI19244-PA | 1..41 | 1..41 | 147 | 70.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10722-PA | 52 | GL10722-PA | 1..51 | 1..51 | 129 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24457-PA | 52 | GA24457-PA | 1..51 | 1..51 | 129 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21678-PA | 51 | GM21678-PA | 1..51 | 1..51 | 254 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11179-PA | 51 | GD11179-PA | 1..51 | 1..51 | 257 | 98 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20321-PA | 56 | GJ20321-PA | 1..50 | 1..50 | 169 | 66 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19313-PA | 48 | GK19313-PA | 1..41 | 1..41 | 160 | 75.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11773-PA | 51 | GE11773-PA | 1..51 | 1..51 | 257 | 98 | Plus |
Translation from 179 to 334
> RH57845.hyp MCLYLGVVEHLVDVVAYCMCRVLELSLFACMMVCGSMRAKLTHGPTNELE Q*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15704-PA | 51 | CG15704-PA | 1..51 | 1..51 | 273 | 100 | Plus |