Clone RH58379 Report

Search the DGRC for RH58379

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:583
Well:79
Vector:pFlc-1
Associated Gene/TranscriptCG8360-RA
Protein status:RH58379.pep: gold
Preliminary Size:709
Sequenced Size:650

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8360 2003-01-01 Sim4 clustering to Release 3
CG8360 2003-02-13 Blastp of sequenced clone
CG8360 2008-04-29 Release 5.5 accounting
CG8360 2008-08-15 Release 5.9 accounting
CG8360 2008-12-18 5.12 accounting

Clone Sequence Records

RH58379.complete Sequence

650 bp (650 high quality bases) assembled on 2003-02-13

GenBank Submission: BT011046

> RH58379.complete
GATTCATTAACAATCGCTTGGCCATGACACAGGTGTTTATCAATGGTGCC
AGAGACGATCTCAATGTACGGGAATTCCAGAGCCTGGATCCTTCGATTCA
AGAGATCATCCTGGCAGCCACGGAAGCCAGAAAACAGGCTTATTGTCCGT
ACAGTAACTTTGCCGTAGGAGCCGCCCTGAGGACCAGCGATGGCACCATA
TACTCCGGTTGCAACATCGAAAACGGGGCGTATGCCACCTGCATTTGTGC
AGAGCGCACTGCAGCCGTCAAGGCCATCAGTGAAGGCAAACGCGACTTTG
TGGCTTGTGCAGTGGTGGCCCAGCAGGATAATGGCTTCACCACGCCTTGT
GGCGTCTGCCGGCAGTTCCTCTCGGAGTTCGTCAACGGCAAGGACATCCC
CCTGTACGCCGCCAAGCCGACCAATCTTCCATTGAGGGTGCTCTGCACCA
GCGTTCTCCAACTGCTGCCCAACGGCTTTAGCTTCGCCAACGGAAAATAG
AAAAGAATATCCCAGCCCAGCCCAGCCGGACAGGGTGCAATCCATGTGCA
ATAGTTTATGTGACATCCCATTTATAATGTTCTGTAAACCCACCCCTCGT
TATTTGTTGATTGAATAGCTTATACGAGATACGGCAAAAAAAAAAAAAAA

RH58379.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG8360-RA 848 CG8360-RA 116..750 2..636 3175 100 Plus
CG8360-RB 684 CG8360-RB 137..684 88..635 2740 100 Plus
CG8360-RB 684 CG8360-RB 73..136 2..65 320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8212758..8213115 278..635 1790 100 Plus
chr2L 23010047 chr2L 8212316..8212509 87..280 970 100 Plus
chr2L 23010047 chr2L 8212177..8212262 2..87 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8213778..8214136 278..636 1795 100 Plus
2L 23513712 2L 8213336..8213529 87..280 970 100 Plus
2L 23513712 2L 8213197..8213282 2..87 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8213778..8214136 278..636 1795 100 Plus
2L 23513712 2L 8213336..8213529 87..280 970 100 Plus
2L 23513712 2L 8213197..8213282 2..87 430 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:43:56 has no hits.

RH58379.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:44:59 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8212317..8212509 88..280 100 -> Plus
chr2L 8212761..8213115 281..635 100   Plus
chr2L 8212176..8212262 1..87 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:40 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 1..477 24..500 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:23 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 1..477 24..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:17:27 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 1..477 24..500 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:22 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 1..477 24..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:18 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 1..477 24..500 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:31:54 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 18..651 1..634 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:23 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 18..652 1..635 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:17:27 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 80..714 1..635 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:22 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 18..651 1..634 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:18 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
CG8360-RA 80..714 1..635 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:59 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8213196..8213282 1..87 98 -> Plus
2L 8213337..8213529 88..280 100 -> Plus
2L 8213781..8214135 281..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:59 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8213196..8213282 1..87 98 -> Plus
2L 8213337..8213529 88..280 100 -> Plus
2L 8213781..8214135 281..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:59 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8213196..8213282 1..87 98 -> Plus
2L 8213337..8213529 88..280 100 -> Plus
2L 8213781..8214135 281..635 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:17:27 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8213196..8213282 1..87 98 -> Plus
arm_2L 8213337..8213529 88..280 100 -> Plus
arm_2L 8213781..8214135 281..635 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:49:00 Download gff for RH58379.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8213781..8214135 281..635 100   Plus
2L 8213196..8213282 1..87 98 -> Plus
2L 8213337..8213529 88..280 100 -> Plus

RH58379.hyp Sequence

Translation from 2 to 499

> RH58379.hyp
FINNRLAMTQVFINGARDDLNVREFQSLDPSIQEIILAATEARKQAYCPY
SNFAVGAALRTSDGTIYSGCNIENGAYATCICAERTAAVKAISEGKRDFV
ACAVVAQQDNGFTTPCGVCRQFLSEFVNGKDIPLYAAKPTNLPLRVLCTS
VLQLLPNGFSFANGK*

RH58379.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8360-PC 158 CG8360-PC 1..158 8..165 822 100 Plus
CG8360-PA 158 CG8360-PA 1..158 8..165 822 100 Plus
CG8353-PB 170 CG8353-PB 1..165 8..159 379 49.4 Plus
CG8353-PA 170 CG8353-PA 1..165 8..159 379 49.4 Plus
CG8349-PA 264 CG8349-PA 124..261 33..160 317 50.4 Plus

RH58379.pep Sequence

Translation from 23 to 499

> RH58379.pep
MTQVFINGARDDLNVREFQSLDPSIQEIILAATEARKQAYCPYSNFAVGA
ALRTSDGTIYSGCNIENGAYATCICAERTAAVKAISEGKRDFVACAVVAQ
QDNGFTTPCGVCRQFLSEFVNGKDIPLYAAKPTNLPLRVLCTSVLQLLPN
GFSFANGK*

RH58379.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15273-PA 158 GF15273-PA 1..158 1..158 794 94.9 Plus
Dana\GF15274-PA 170 GF15274-PA 20..165 18..152 343 49 Plus
Dana\GF15275-PA 264 GF15275-PA 116..261 18..153 322 49 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10525-PA 158 GG10525-PA 1..158 1..158 810 96.8 Plus
Dere\GG10526-PA 170 GG10526-PA 1..165 1..152 387 50 Plus
Dere\GG10527-PA 264 GG10527-PA 124..261 26..153 324 53.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11513-PA 159 GH11513-PA 1..159 1..158 675 83.6 Plus
Dgri\GH11514-PA 168 GH11514-PA 16..165 14..152 351 48.7 Plus
Dgri\GH11515-PA 221 GH11515-PA 76..218 18..152 305 47.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8360-PC 158 CG8360-PC 1..158 1..158 822 100 Plus
CG8360-PA 158 CG8360-PA 1..158 1..158 822 100 Plus
CG8353-PB 170 CG8353-PB 1..165 1..152 379 49.4 Plus
CG8353-PA 170 CG8353-PA 1..165 1..152 379 49.4 Plus
CG8349-PA 264 CG8349-PA 124..261 26..153 317 50.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17009-PA 159 GI17009-PA 1..159 1..158 694 83.6 Plus
Dmoj\GI17010-PA 173 GI17010-PA 20..169 18..152 333 44 Plus
Dmoj\GI17011-PA 220 GI17011-PA 76..219 18..153 331 50.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18729-PA 158 GL18729-PA 1..158 1..158 755 89.9 Plus
Dper\GL18730-PA 170 GL18730-PA 1..165 1..152 374 48.2 Plus
Dper\GL18731-PA 227 GL18731-PA 82..224 21..153 317 49.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21017-PA 158 GA21017-PA 1..158 1..158 755 89.9 Plus
Dpse\GA21012-PA 170 GA21012-PA 1..165 1..152 379 48.8 Plus
Dpse\GA21010-PA 227 GA21010-PA 82..224 21..153 321 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16857-PA 158 GM16857-PA 1..158 1..158 815 98.1 Plus
Dsec\GM16858-PA 170 GM16858-PA 1..165 1..152 390 50.6 Plus
Dsec\GM16862-PA 264 GM16862-PA 124..261 26..153 324 51.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23515-PA 158 GD23515-PA 1..158 1..158 827 99.4 Plus
Dsim\GD23516-PA 170 GD23516-PA 1..165 1..152 388 50.6 Plus
Dsim\GD23517-PA 264 GD23517-PA 124..261 26..153 327 51.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24345-PA 159 GJ24345-PA 1..159 1..158 716 85.5 Plus
Dvir\GJ24356-PA 167 GJ24356-PA 16..165 14..153 329 46.7 Plus
Dvir\GJ24367-PA 221 GJ24367-PA 76..219 18..153 328 50.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15159-PA 170 GK15159-PA 1..165 1..152 342 46.4 Plus
Dwil\GK15160-PA 216 GK15160-PA 61..215 12..158 322 46.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18745-PA 158 GE18745-PA 1..158 1..158 823 98.7 Plus
Dyak\GE18746-PA 170 GE18746-PA 1..165 1..152 392 50.6 Plus
Dyak\GE18747-PA 264 GE18747-PA 124..261 26..153 315 51.8 Plus