Clone RH58567 Report

Search the DGRC for RH58567

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:585
Well:67
Vector:pFlc-1
Associated Gene/Transcriptcag-RA
Protein status:RH58567.pep: gold
Preliminary Size:1281
Sequenced Size:885

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12346 2002-01-01 Sim4 clustering to Release 2
CG12346 2003-01-01 Sim4 clustering to Release 3
CG12346 2003-01-22 Blastp of sequenced clone
cag 2008-04-29 Release 5.5 accounting
cag 2008-08-15 Release 5.9 accounting
cag 2008-12-18 5.12 accounting

Clone Sequence Records

RH58567.complete Sequence

885 bp (885 high quality bases) assembled on 2003-01-22

GenBank Submission: BT003445

> RH58567.complete
GGTATACTTCATCGCTCTGGTCATACAACACCACATATCTGTGGACGGAC
GGACACTCCCTTGAGCGGACAAGAAAACTGTCTAATTTGGTAGCAATTTC
GACAGATAAAAGTCTTCATCGCTCACTAGTAATGTTCGTCGACAAATATG
CCATCGGGAAGAGTCAGAAAACCTAGAACCTCGCTCACTTTGGAAGAGAA
AATGGAGGTAATCCAGTCCCAGGAGCGAAACAAGCTATCGGTTCGGGATC
TGGCCAAGAGGTTTAACATTGGAAAGACACAAGCAGCAGACATTTTGAAG
CACAAACAGTCGATTAAAGAGGGTCTGTTGAGTGGAGAACTTAAGTTGAA
TCAGATGCGGAGGAATCCCCTCTCTCAGCGGGGCGCCCAAATCGATGAGA
TGTGCTTTGATTGGTTCTCCCGTGTCCGTACCGAGAATATACCCATATCG
GGGGAAATGGTGCGGAAGAAGGCCAAGCAGTTAGCTGTGGAGCTGGGCCA
CTCCAATTTCTCTGCCTCCTCCGGATGGCTGGAGAAATGGCGAAAGCGAC
ACAACGTCCGATACAATGACACCGGTGACAGCCTGGATCTGCAGGAGTTC
GAGGCGATTCTGGTGAAAAGCGAACCCATCTCGAATAAGGACGATTGTGA
TGAGCCATACCCCGTGACTCTGATAGAGCCTATCTATTCCACCGAGGAGG
CCATGATGCAGCTGGCCCGGCTGAAGGAGTTCGCAAAGGATGACTATGCT
TCCTACCAGCAGTTGATCAGTCTGGAAAATCAATGGAGCTGGAAATGGAA
CATCTTTAAGAAGGAGCTTCCCTGACCCAAGCATGCAATTTAGGTGCAAT
ATAAATACATATTTATCTCAAAAAAAAAAAAAAAA

RH58567.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
cag-RA 1290 cag-RA 255..1122 2..869 4340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:44:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6780784..6781394 869..259 3040 99.8 Minus
chr2R 21145070 chr2R 6781448..6781708 262..2 1305 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10893191..10893801 869..259 3055 100 Minus
2R 25286936 2R 10893855..10894115 262..2 1305 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10894390..10895000 869..259 3055 100 Minus
2R 25260384 2R 10895054..10895314 262..2 1305 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:44:03 has no hits.

RH58567.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:03 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6781450..6781708 1..260 99   Minus
chr2R 6780784..6781392 261..869 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:43 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 1..678 148..825 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:53:46 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 1..678 148..825 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:17:34 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 1..678 148..825 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:44:50 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 1..678 148..825 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:28 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 1..678 148..825 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:08:22 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 245..1113 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:53:46 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 245..1113 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:17:34 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 299..1167 1..869 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:44:51 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 245..1113 1..869 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:28 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
cag-RA 299..1167 1..869 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10893191..10893799 261..869 100 <- Minus
2R 10893857..10894115 1..260 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10893191..10893799 261..869 100 <- Minus
2R 10893857..10894115 1..260 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10893191..10893799 261..869 100 <- Minus
2R 10893857..10894115 1..260 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:17:34 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6780696..6781304 261..869 100 <- Minus
arm_2R 6781362..6781620 1..260 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:15:46 Download gff for RH58567.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10894390..10894998 261..869 100 <- Minus
2R 10895056..10895314 1..260 99   Minus

RH58567.pep Sequence

Translation from 147 to 824

> RH58567.pep
MPSGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADIL
KHKQSIKEGLLSGELKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPI
SGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNVRYNDTGDSLDLQE
FEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDDY
ASYQQLISLENQWSWKWNIFKKELP*

RH58567.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13390-PA 222 GF13390-PA 1..222 1..225 730 59.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:07:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22708-PA 207 GG22708-PA 1..207 19..225 1050 93.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
cag-PB 225 CG12346-PB 1..225 1..225 1169 100 Plus
cag-PA 225 CG12346-PA 1..225 1..225 1169 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17090-PA 228 GL17090-PA 1..225 1..223 664 58.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11571-PA 228 GA11571-PA 1..225 1..223 641 57.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20484-PA 225 GM20484-PA 1..225 1..225 1143 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15259-PA 111 GD15259-PA 1..108 1..108 555 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16124-PA 227 GJ16124-PA 7..216 13..212 368 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19073-PA 222 GK19073-PA 9..198 13..201 353 40.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13064-PA 225 GE13064-PA 1..225 1..225 1117 92.4 Plus

RH58567.hyp Sequence

Translation from 147 to 824

> RH58567.hyp
MPSGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADIL
KHKQSIKEGLLSGELKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPI
SGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNVRYNDTGDSLDLQE
FEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDDY
ASYQQLISLENQWSWKWNIFKKELP*

RH58567.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
cag-PB 225 CG12346-PB 1..225 1..225 1169 100 Plus
cag-PA 225 CG12346-PA 1..225 1..225 1169 100 Plus