RH58567.complete Sequence
885 bp (885 high quality bases) assembled on 2003-01-22
GenBank Submission: BT003445
> RH58567.complete
GGTATACTTCATCGCTCTGGTCATACAACACCACATATCTGTGGACGGAC
GGACACTCCCTTGAGCGGACAAGAAAACTGTCTAATTTGGTAGCAATTTC
GACAGATAAAAGTCTTCATCGCTCACTAGTAATGTTCGTCGACAAATATG
CCATCGGGAAGAGTCAGAAAACCTAGAACCTCGCTCACTTTGGAAGAGAA
AATGGAGGTAATCCAGTCCCAGGAGCGAAACAAGCTATCGGTTCGGGATC
TGGCCAAGAGGTTTAACATTGGAAAGACACAAGCAGCAGACATTTTGAAG
CACAAACAGTCGATTAAAGAGGGTCTGTTGAGTGGAGAACTTAAGTTGAA
TCAGATGCGGAGGAATCCCCTCTCTCAGCGGGGCGCCCAAATCGATGAGA
TGTGCTTTGATTGGTTCTCCCGTGTCCGTACCGAGAATATACCCATATCG
GGGGAAATGGTGCGGAAGAAGGCCAAGCAGTTAGCTGTGGAGCTGGGCCA
CTCCAATTTCTCTGCCTCCTCCGGATGGCTGGAGAAATGGCGAAAGCGAC
ACAACGTCCGATACAATGACACCGGTGACAGCCTGGATCTGCAGGAGTTC
GAGGCGATTCTGGTGAAAAGCGAACCCATCTCGAATAAGGACGATTGTGA
TGAGCCATACCCCGTGACTCTGATAGAGCCTATCTATTCCACCGAGGAGG
CCATGATGCAGCTGGCCCGGCTGAAGGAGTTCGCAAAGGATGACTATGCT
TCCTACCAGCAGTTGATCAGTCTGGAAAATCAATGGAGCTGGAAATGGAA
CATCTTTAAGAAGGAGCTTCCCTGACCCAAGCATGCAATTTAGGTGCAAT
ATAAATACATATTTATCTCAAAAAAAAAAAAAAAA
RH58567.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:23:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cag-RA | 1290 | cag-RA | 255..1122 | 2..869 | 4340 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:44:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 6780784..6781394 | 869..259 | 3040 | 99.8 | Minus |
chr2R | 21145070 | chr2R | 6781448..6781708 | 262..2 | 1305 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10893191..10893801 | 869..259 | 3055 | 100 | Minus |
2R | 25286936 | 2R | 10893855..10894115 | 262..2 | 1305 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:01:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 10894390..10895000 | 869..259 | 3055 | 100 | Minus |
2R | 25260384 | 2R | 10895054..10895314 | 262..2 | 1305 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 15:44:03 has no hits.
RH58567.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:03 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 6781450..6781708 | 1..260 | 99 | | Minus |
chr2R | 6780784..6781392 | 261..869 | 99 | <- | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:43 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 1..678 | 148..825 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:53:46 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 1..678 | 148..825 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:17:34 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 1..678 | 148..825 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:44:50 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 1..678 | 148..825 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:28 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 1..678 | 148..825 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:08:22 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 245..1113 | 1..869 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:53:46 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 245..1113 | 1..869 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:17:34 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 299..1167 | 1..869 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:44:51 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 245..1113 | 1..869 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:28 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cag-RA | 299..1167 | 1..869 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10893191..10893799 | 261..869 | 100 | <- | Minus |
2R | 10893857..10894115 | 1..260 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10893191..10893799 | 261..869 | 100 | <- | Minus |
2R | 10893857..10894115 | 1..260 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:03 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10893191..10893799 | 261..869 | 100 | <- | Minus |
2R | 10893857..10894115 | 1..260 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:17:34 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6780696..6781304 | 261..869 | 100 | <- | Minus |
arm_2R | 6781362..6781620 | 1..260 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:15:46 Download gff for
RH58567.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10894390..10894998 | 261..869 | 100 | <- | Minus |
2R | 10895056..10895314 | 1..260 | 99 | | Minus |
RH58567.pep Sequence
Translation from 147 to 824
> RH58567.pep
MPSGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADIL
KHKQSIKEGLLSGELKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPI
SGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNVRYNDTGDSLDLQE
FEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDDY
ASYQQLISLENQWSWKWNIFKKELP*
RH58567.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:07:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13390-PA | 222 | GF13390-PA | 1..222 | 1..225 | 730 | 59.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:07:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22708-PA | 207 | GG22708-PA | 1..207 | 19..225 | 1050 | 93.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cag-PB | 225 | CG12346-PB | 1..225 | 1..225 | 1169 | 100 | Plus |
cag-PA | 225 | CG12346-PA | 1..225 | 1..225 | 1169 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:07:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL17090-PA | 228 | GL17090-PA | 1..225 | 1..223 | 664 | 58.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:07:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11571-PA | 228 | GA11571-PA | 1..225 | 1..223 | 641 | 57.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:07:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20484-PA | 225 | GM20484-PA | 1..225 | 1..225 | 1143 | 94.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:07:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15259-PA | 111 | GD15259-PA | 1..108 | 1..108 | 555 | 97.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:07:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16124-PA | 227 | GJ16124-PA | 7..216 | 13..212 | 368 | 39.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:07:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19073-PA | 222 | GK19073-PA | 9..198 | 13..201 | 353 | 40.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:07:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13064-PA | 225 | GE13064-PA | 1..225 | 1..225 | 1117 | 92.4 | Plus |
RH58567.hyp Sequence
Translation from 147 to 824
> RH58567.hyp
MPSGRVRKPRTSLTLEEKMEVIQSQERNKLSVRDLAKRFNIGKTQAADIL
KHKQSIKEGLLSGELKLNQMRRNPLSQRGAQIDEMCFDWFSRVRTENIPI
SGEMVRKKAKQLAVELGHSNFSASSGWLEKWRKRHNVRYNDTGDSLDLQE
FEAILVKSEPISNKDDCDEPYPVTLIEPIYSTEEAMMQLARLKEFAKDDY
ASYQQLISLENQWSWKWNIFKKELP*
RH58567.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cag-PB | 225 | CG12346-PB | 1..225 | 1..225 | 1169 | 100 | Plus |
cag-PA | 225 | CG12346-PA | 1..225 | 1..225 | 1169 | 100 | Plus |