Clone RH58911 Report

Search the DGRC for RH58911

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:589
Well:11
Vector:pFlc-1
Associated Gene/TranscriptIM3-RA
Protein status:RH58911.pep: gold
Sequenced Size:314

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
IM3 2008-04-29 Release 5.5 accounting
IM3 2008-08-15 Release 5.9 accounting
IM3 2008-12-18 5.12 accounting

Clone Sequence Records

RH58911.complete Sequence

314 bp (314 high quality bases) assembled on 2002-10-15

GenBank Submission: BT001850

> RH58911.complete
GATCAGTTGTCAACGGCTAATACGCGGGAGTCAAGCTCAGAATTCAACCA
CAAAAACCAACAACATGAAATTCCTATCACTCGCCTTCGTTTTGGGTCTG
CTGGCTCTGGCCAACGCCACTCCCCTGAATCCTGGCAATGTCATCATCAA
TGGCGATTGCCGCGTCTGCAATGTGAGGGCCTAAGGGCAGCGGAGAATGA
AGGATGCCAGTTGAAGTTCACACAGCCACACATATTTTTAAGTCGAAAAT
GTAATAGAAATTCCTAGAATCAAGTGCCCATATTAAATATATTCCAAACA
AAAAAAAAAAAAAA

RH58911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
IM3-RA 675 IM3-RA 134..435 2..303 1510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14275335..14275508 116..289 855 99.4 Plus
chr2R 21145070 chr2R 14275150..14275264 2..116 575 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18388307..18388494 116..303 940 100 Plus
2R 25286936 2R 18388122..18388236 2..116 575 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18389506..18389693 116..303 940 100 Plus
2R 25260384 2R 18389321..18389435 2..116 575 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:40:19 has no hits.

RH58911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:41:20 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14275336..14275508 117..289 99   Plus
chr2R 14275148..14275264 1..116 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:48 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..120 65..184 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:01:46 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..120 65..184 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:10:05 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..120 65..184 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:01:37 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..120 65..184 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:40:56 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..120 65..184 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:26:53 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..300 1..299 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:01:46 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..300 1..299 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:10:05 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 2..301 1..299 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:01:37 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 1..300 1..299 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:40:56 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
IM3-RA 2..301 1..299 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:20 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18388308..18388490 117..299 100   Plus
2R 18388120..18388236 1..116 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:20 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18388308..18388490 117..299 100   Plus
2R 18388120..18388236 1..116 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:41:20 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18388308..18388490 117..299 100   Plus
2R 18388120..18388236 1..116 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:10:05 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14275625..14275741 1..116 99 -> Plus
arm_2R 14275813..14275995 117..299 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:36:37 Download gff for RH58911.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18389319..18389435 1..116 99 -> Plus
2R 18389507..18389689 117..299 100   Plus

RH58911.hyp Sequence

Translation from 0 to 266

> RH58911.hyp
HQLSTANTRESSSEFNHKNQQHEIPITRLRFGSAGSGQRHSPESWQCHHQ
WRLPRLQCEGLRAAENEGCQLKFTQPHIFLSRKCNRNS*
Sequence RH58911.hyp has no blast hits.

RH58911.pep Sequence

Translation from 64 to 183

> RH58911.pep
MKFLSLAFVLGLLALANATPLNPGNVIINGDCRVCNVRA*

RH58911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12155-PA 45 GF12155-PA 1..43 1..39 132 69.8 Plus
Dana\GF12767-PA 40 GF12767-PA 1..39 1..39 126 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21877-PA 39 GG21877-PA 1..39 1..39 188 97.4 Plus
Dere\GG21874-PA 45 GG21874-PA 1..43 1..39 133 69.8 Plus
Dere\GG21876-PA 45 GG21876-PA 1..43 1..39 131 67.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23858-PA 40 GH23858-PA 1..39 1..39 140 71.8 Plus
Dgri\GH20220-PA 39 GH20220-PA 1..38 1..39 129 69.2 Plus
Dgri\GH21665-PA 40 GH21665-PA 1..39 1..39 128 66.7 Plus
Dgri\GH13934-PA 40 GH13934-PA 1..39 1..39 128 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
IM3-PB 39 CG16844-PB 1..39 1..39 199 100 Plus
IM3-PA 39 CG16844-PA 1..39 1..39 199 100 Plus
CG15068-PA 40 CG15068-PA 1..38 1..38 157 73.7 Plus
CG15065-PA 40 CG15065-PA 1..38 1..38 154 76.3 Plus
IM1-PA 45 CG18108-PA 1..41 1..37 140 75.6 Plus
IM2-PA 45 CG18106-PA 1..41 1..37 130 68.3 Plus
CG18107-PA 45 CG18107-PA 1..42 1..38 127 69 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20115-PA 45 GI20115-PA 1..43 1..39 130 67.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:52:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17765-PA 40 GL17765-PA 1..40 1..39 174 92.5 Plus
Dper\GL16705-PA 40 GL16705-PA 1..39 1..39 163 79.5 Plus
Dper\GL17764-PA 45 GL17764-PA 1..43 1..39 130 67.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:52:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24904-PA 40 GA24904-PA 1..40 1..39 174 92.5 Plus
Dpse\GA30478-PA 40 GA30478-PA 1..39 1..39 164 79.5 Plus
Dpse\GA14796-PA 45 GA14796-PA 1..43 1..39 130 67.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21872-PA 40 GM21872-PA 1..39 1..39 149 71.8 Plus
Dsec\GM21866-PA 45 GM21866-PA 1..43 1..39 136 72.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11366-PA 39 GD11366-PA 1..39 1..39 186 97.4 Plus
Dsim\GD11363-PA 45 GD11363-PA 1..43 1..39 132 69.8 Plus
Dsim\GD11365-PA 45 GD11365-PA 1..43 1..39 130 67.4 Plus
Dsim\GD11368-PA 40 GD11368-PA 1..35 1..35 126 68.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:52:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22451-PA 40 GJ22451-PA 1..38 1..38 157 78.9 Plus
Dvir\GJ19885-PA 45 GJ19885-PA 1..43 1..39 126 65.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22978-PA 40 GK22978-PA 1..40 1..39 176 95 Plus
Dwil\GK23235-PA 40 GK23235-PA 1..39 1..39 167 79.5 Plus
Dwil\GK23991-PA 40 GK23991-PA 1..39 1..39 162 76.9 Plus
Dwil\GK23232-PA 68 GK23232-PA 1..43 1..39 132 67.4 Plus
Dwil\GK22977-PA 45 GK22977-PA 1..43 1..39 130 67.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:52:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11953-PA 40 GE11953-PA 1..39 1..39 146 71.8 Plus