BDGP Sequence Production Resources |
Search the DGRC for RH59211
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 592 |
Well: | 11 |
Vector: | pFlc-1 |
Associated Gene/Transcript | ATPsyn-d-RA |
Protein status: | RH59211.pep: gold |
Preliminary Size: | 679 |
Sequenced Size: | 712 |
Gene | Date | Evidence |
---|---|---|
CG6030 | 2002-01-01 | Sim4 clustering to Release 2 |
CG6030 | 2002-06-11 | Blastp of sequenced clone |
CG6030 | 2003-01-01 | Sim4 clustering to Release 3 |
ATPsyn-d | 2008-04-29 | Release 5.5 accounting |
712 bp (712 high quality bases) assembled on 2002-06-11
GenBank Submission: AY071751
> RH59211.complete CATTGGGTCACATTCGTACTCAAAGTTATCTGTGCAGAATGGCCGCCCGC CGTATCGCCCAATCCTCGATCAACTGGTCCGCTCTCGCCGAGCGCGTGCC CGCCAACCAGAAGAGCAGCTTCGGCGCCTTCAAGACCAAGTCGGACATCT ATGTGCGCGCCGTGCTGGCCAATCCCGAGTGCCCACCCCAGATCGATTGG GCCAACTACAAGAAGCTTGTGCCAGTGGCCGGACTCGTCGATAGCTTCCA GAAGCAGTACGAAGCCCTGAAGGTGCCCTATCCCCAGGACAAGGTGTCGT CCCAGGTGGATGCCGAGATCAAGGCGTCGCAGAGCGAAATCGATGCCTAC AAGAAGGCCTCGGAGCAGCGCATTCAGAACTACCAAAAGGAGATCGCCCA TCTCAAGTCTCTGCTGCCCTACGACCAGATGACCATGGAGGACTACCGCG ACGCATTCCCCGATAGCGCACTCGATCCCCTCAACAAGCCTACCTTCTGG CCCCACACTCCCGAGGAGCAGGTCGGCTACAAGTCCAAGGAGCAGCTGGA GGCCGAAGCCCAGGGACACCACTAAACCGGAGCGCACGAGGAGCACTCTG ACACTGGCTTCGTTGGTCGTCTGTTCGATTCGAAATGTAATCCGCGTTGA AGTAAATTACCCAAATTAAATTCATTTCAAATGACAGTTACGGTATCTAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14919387..14920058 | 27..698 | 3330 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 19095397..19096070 | 27..700 | 3355 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18836228..18836901 | 27..700 | 3355 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14919387..14920058 | 27..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RA | 1..537 | 39..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RA | 1..537 | 39..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 1..537 | 39..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RA | 1..537 | 39..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 1..537 | 39..575 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 1..696 | 4..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 11..707 | 1..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 11..707 | 1..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 1..696 | 4..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ATPsyn-d-RB | 2..694 | 6..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19095397..19096068 | 27..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19095397..19096068 | 27..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 19095397..19096068 | 27..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14921119..14921790 | 27..698 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18836228..18836899 | 27..698 | 99 | Plus |
Translation from 27 to 574
> RH59211.hyp YLCRMAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANP ECPPQIDWANYKKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKA SQSEIDAYKKASEQRIQNYQKEIAHLKSLLPYDQMTMEDYRDAFPDSALD PLNKPTFWPHTPEEQVGYKSKEQLEAEAQGHH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsyn-d-PC | 178 | CG6030-PC | 1..178 | 5..182 | 929 | 100 | Plus |
ATPsyn-d-PA | 178 | CG6030-PA | 1..178 | 5..182 | 929 | 100 | Plus |
ATPsyn-d-PB | 178 | CG6030-PB | 1..178 | 5..182 | 929 | 100 | Plus |
CG7813-PA | 734 | CG7813-PA | 19..200 | 8..182 | 241 | 33.7 | Plus |
Translation from 38 to 574
> RH59211.pep MAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPP QIDWANYKKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSE IDAYKKASEQRIQNYQKEIAHLKSLLPYDQMTMEDYRDAFPDSALDPLNK PTFWPHTPEEQVGYKSKEQLEAEAQGHH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16047-PA | 178 | GF16047-PA | 1..178 | 1..178 | 886 | 92.7 | Plus |
Dana\GF11261-PA | 716 | GF11261-PA | 25..184 | 12..162 | 227 | 35 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23134-PA | 178 | GG23134-PA | 1..178 | 1..178 | 937 | 99.4 | Plus |
Dere\GG22264-PA | 737 | GG22264-PA | 17..185 | 2..161 | 219 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18181-PA | 178 | GH18181-PA | 1..178 | 1..178 | 858 | 89.9 | Plus |
Dgri\GH20643-PA | 660 | GH20643-PA | 19..180 | 9..161 | 239 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsynD-PC | 178 | CG6030-PC | 1..178 | 1..178 | 929 | 100 | Plus |
ATPsynD-PA | 178 | CG6030-PA | 1..178 | 1..178 | 929 | 100 | Plus |
ATPsynD-PB | 178 | CG6030-PB | 1..178 | 1..178 | 929 | 100 | Plus |
knon-PA | 734 | CG7813-PA | 19..200 | 4..178 | 241 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10758-PA | 178 | GI10758-PA | 1..178 | 1..178 | 846 | 88.8 | Plus |
Dmoj\GI19008-PA | 696 | GI19008-PA | 22..196 | 11..176 | 274 | 40.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23817-PA | 178 | GL23817-PA | 1..178 | 1..178 | 858 | 88.8 | Plus |
Dper\GL11340-PA | 613 | GL11340-PA | 32..195 | 8..162 | 263 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22433-PA | 178 | GA22433-PA | 1..178 | 1..178 | 864 | 89.3 | Plus |
Dpse\GA20604-PA | 713 | GA20604-PA | 32..195 | 8..162 | 264 | 37.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23327-PA | 178 | GM23327-PA | 1..178 | 1..178 | 933 | 98.9 | Plus |
Dsec\GM20053-PA | 733 | GM20053-PA | 17..200 | 2..178 | 209 | 32.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19270-PA | 187 | GD19270-PA | 1..187 | 1..178 | 904 | 93 | Plus |
Dsim\GD25534-PA | 731 | GD25534-PA | 17..200 | 2..178 | 209 | 32.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14360-PA | 178 | GJ14360-PA | 1..178 | 1..178 | 833 | 87.1 | Plus |
Dvir\GJ19972-PA | 693 | GJ19972-PA | 19..180 | 9..161 | 222 | 35.2 | Plus |