Clone RH59211 Report

Search the DGRC for RH59211

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:592
Well:11
Vector:pFlc-1
Associated Gene/TranscriptATPsyn-d-RA
Protein status:RH59211.pep: gold
Preliminary Size:679
Sequenced Size:712

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6030 2002-01-01 Sim4 clustering to Release 2
CG6030 2002-06-11 Blastp of sequenced clone
CG6030 2003-01-01 Sim4 clustering to Release 3
ATPsyn-d 2008-04-29 Release 5.5 accounting

Clone Sequence Records

RH59211.complete Sequence

712 bp (712 high quality bases) assembled on 2002-06-11

GenBank Submission: AY071751

> RH59211.complete
CATTGGGTCACATTCGTACTCAAAGTTATCTGTGCAGAATGGCCGCCCGC
CGTATCGCCCAATCCTCGATCAACTGGTCCGCTCTCGCCGAGCGCGTGCC
CGCCAACCAGAAGAGCAGCTTCGGCGCCTTCAAGACCAAGTCGGACATCT
ATGTGCGCGCCGTGCTGGCCAATCCCGAGTGCCCACCCCAGATCGATTGG
GCCAACTACAAGAAGCTTGTGCCAGTGGCCGGACTCGTCGATAGCTTCCA
GAAGCAGTACGAAGCCCTGAAGGTGCCCTATCCCCAGGACAAGGTGTCGT
CCCAGGTGGATGCCGAGATCAAGGCGTCGCAGAGCGAAATCGATGCCTAC
AAGAAGGCCTCGGAGCAGCGCATTCAGAACTACCAAAAGGAGATCGCCCA
TCTCAAGTCTCTGCTGCCCTACGACCAGATGACCATGGAGGACTACCGCG
ACGCATTCCCCGATAGCGCACTCGATCCCCTCAACAAGCCTACCTTCTGG
CCCCACACTCCCGAGGAGCAGGTCGGCTACAAGTCCAAGGAGCAGCTGGA
GGCCGAAGCCCAGGGACACCACTAAACCGGAGCGCACGAGGAGCACTCTG
ACACTGGCTTCGTTGGTCGTCTGTTCGATTCGAAATGTAATCCGCGTTGA
AGTAAATTACCCAAATTAAATTCATTTCAAATGACAGTTACGGTATCTAA
AAAAAAAAAAAA

RH59211.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-RB 945 ATPsyn-d-RB 50..744 6..700 3460 99.8 Plus
ATPsyn-d.a 693 ATPsyn-d.a 20..693 27..700 3355 99.8 Plus
ATPsyn-d-RA 958 ATPsyn-d-RA 84..757 27..700 3355 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:31:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14919387..14920058 27..698 3330 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:34:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19095397..19096070 27..700 3355 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18836228..18836901 27..700 3355 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 04:31:05 has no hits.

RH59211.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:31:58 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14919387..14920058 27..698 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:51 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 1..537 39..575 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:41 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 1..537 39..575 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:32:08 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 1..537 39..575 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:15 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RA 1..537 39..575 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:42:00 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 1..537 39..575 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:14 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 1..696 4..698 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:40 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 11..707 1..698 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:32:08 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 11..707 1..698 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:16 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 1..696 4..698 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:42:00 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-d-RB 2..694 6..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:58 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19095397..19096068 27..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:58 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19095397..19096068 27..698 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:58 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19095397..19096068 27..698 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:32:08 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14921119..14921790 27..698 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:20 Download gff for RH59211.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18836228..18836899 27..698 99   Plus

RH59211.hyp Sequence

Translation from 27 to 574

> RH59211.hyp
YLCRMAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANP
ECPPQIDWANYKKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKA
SQSEIDAYKKASEQRIQNYQKEIAHLKSLLPYDQMTMEDYRDAFPDSALD
PLNKPTFWPHTPEEQVGYKSKEQLEAEAQGHH*

RH59211.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-d-PC 178 CG6030-PC 1..178 5..182 929 100 Plus
ATPsyn-d-PA 178 CG6030-PA 1..178 5..182 929 100 Plus
ATPsyn-d-PB 178 CG6030-PB 1..178 5..182 929 100 Plus
CG7813-PA 734 CG7813-PA 19..200 8..182 241 33.7 Plus

RH59211.pep Sequence

Translation from 38 to 574

> RH59211.pep
MAARRIAQSSINWSALAERVPANQKSSFGAFKTKSDIYVRAVLANPECPP
QIDWANYKKLVPVAGLVDSFQKQYEALKVPYPQDKVSSQVDAEIKASQSE
IDAYKKASEQRIQNYQKEIAHLKSLLPYDQMTMEDYRDAFPDSALDPLNK
PTFWPHTPEEQVGYKSKEQLEAEAQGHH*

RH59211.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16047-PA 178 GF16047-PA 1..178 1..178 886 92.7 Plus
Dana\GF11261-PA 716 GF11261-PA 25..184 12..162 227 35 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23134-PA 178 GG23134-PA 1..178 1..178 937 99.4 Plus
Dere\GG22264-PA 737 GG22264-PA 17..185 2..161 219 33.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18181-PA 178 GH18181-PA 1..178 1..178 858 89.9 Plus
Dgri\GH20643-PA 660 GH20643-PA 19..180 9..161 239 35.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynD-PC 178 CG6030-PC 1..178 1..178 929 100 Plus
ATPsynD-PA 178 CG6030-PA 1..178 1..178 929 100 Plus
ATPsynD-PB 178 CG6030-PB 1..178 1..178 929 100 Plus
knon-PA 734 CG7813-PA 19..200 4..178 241 33.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10758-PA 178 GI10758-PA 1..178 1..178 846 88.8 Plus
Dmoj\GI19008-PA 696 GI19008-PA 22..196 11..176 274 40.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23817-PA 178 GL23817-PA 1..178 1..178 858 88.8 Plus
Dper\GL11340-PA 613 GL11340-PA 32..195 8..162 263 37.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22433-PA 178 GA22433-PA 1..178 1..178 864 89.3 Plus
Dpse\GA20604-PA 713 GA20604-PA 32..195 8..162 264 37.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23327-PA 178 GM23327-PA 1..178 1..178 933 98.9 Plus
Dsec\GM20053-PA 733 GM20053-PA 17..200 2..178 209 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19270-PA 187 GD19270-PA 1..187 1..178 904 93 Plus
Dsim\GD25534-PA 731 GD25534-PA 17..200 2..178 209 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14360-PA 178 GJ14360-PA 1..178 1..178 833 87.1 Plus
Dvir\GJ19972-PA 693 GJ19972-PA 19..180 9..161 222 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13576-PA 178 GK13576-PA 1..178 1..178 872 90.4 Plus
Dwil\GK21701-PA 961 GK21701-PA 23..182 11..161 256 38.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\ATPsyn-d-PA 178 GE25580-PA 1..178 1..178 935 98.9 Plus
Dyak\GE14057-PA 733 GE14057-PA 17..200 2..178 229 34.9 Plus