Clone RH59219 Report

Search the DGRC for RH59219

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:592
Well:19
Vector:pFlc-1
Associated Gene/TranscriptCG3176-RA
Protein status:RH59219.pep: gold
Preliminary Size:366
Sequenced Size:534

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3176 2002-01-01 Sim4 clustering to Release 2
CG3176 2003-01-01 Sim4 clustering to Release 3
CG3176 2008-04-29 Release 5.5 accounting
CG3176 2008-08-15 Release 5.9 accounting
CG3176 2008-12-18 5.12 accounting

Clone Sequence Records

RH59219.complete Sequence

534 bp (534 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113606

> RH59219.complete
GATTGCAATTTGGAAATTTTAAGGGTTCTGATTGCACTTCTCGCTGACCT
CAAACAAATCAAAGAAGACAATCAAAATGCTTTTCGATGGCGAAACCGGC
AATGGGCAAGGTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCA
GGAGGAGCCCGCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCA
TCATTCTGCGCAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCG
CGCTGCTGCCAGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGT
GATGGATCTCTGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGT
TTATTTGCCGCAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAG
GAGGATCCGCTGTGCGAGCACTGCCAGATGTTCCTCAGCTAGGGCATCAA
ACAATCAAGCAAATGTCAAATGTATTACGTTTTAAAGAATATAGAGCTAT
ATAGTATTTAACATTAGACAAAAAAAAAAAAAAA

RH59219.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3176-RA 707 CG3176-RA 78..600 2..524 2600 99.8 Plus
CG32817.c 1561 CG32817.c 45..567 2..524 2540 99 Plus
CG32817.b 1840 CG32817.b 324..846 2..524 2540 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 376151..376466 63..378 1580 100 Plus
chrX 22417052 chrX 373663..373978 63..378 1550 99.4 Plus
chrX 22417052 chrX 371640..371964 63..378 1095 89.8 Plus
chrX 22417052 chrX 376551..376689 379..517 695 100 Plus
chrX 22417052 chrX 374063..374200 379..516 675 99.3 Plus
chrX 22417052 chrX 373482..373542 2..62 305 100 Plus
chrX 22417052 chrX 375970..376030 2..62 305 100 Plus
chrX 22417052 chrX 372046..372128 379..461 280 89.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 482118..482433 63..378 1580 100 Plus
X 23542271 X 479630..479945 63..378 1550 99.4 Plus
X 23542271 X 477607..477931 63..378 1095 89.8 Plus
X 23542271 X 482518..482663 379..524 715 99.3 Plus
X 23542271 X 480030..480175 379..524 685 97.9 Plus
X 23542271 X 479449..479509 2..62 305 100 Plus
X 23542271 X 481937..481997 2..62 305 100 Plus
X 23542271 X 478013..478095 379..461 280 89.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 490216..490531 63..378 1580 100 Plus
X 23527363 X 487728..488043 63..378 1550 99.3 Plus
X 23527363 X 490616..490761 379..524 715 99.3 Plus
X 23527363 X 488128..488273 379..524 685 97.9 Plus
X 23527363 X 485705..485886 63..244 655 90.6 Plus
X 23527363 X 485894..486029 243..378 575 94.8 Plus
X 23527363 X 490035..490095 2..62 305 100 Plus
X 23527363 X 487547..487607 2..62 305 100 Plus
X 23527363 X 486111..486193 379..461 280 89.1 Plus
Blast to na_te.dros performed on 2019-03-15 20:35:23 has no hits.

RH59219.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:36:15 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 375969..376030 1..62 98 -> Plus
chrX 376151..376466 63..378 100 -> Plus
chrX 376551..376691 379..519 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:51 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:26 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:16:26 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:29 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:24:52 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..366 77..442 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:35:15 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 77..595 1..519 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:26 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 75..593 1..519 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:16:26 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..517 3..519 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:29 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 2..519 2..519 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:24:52 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 1..517 3..519 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:15 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
X 481936..481997 1..62 98 -> Plus
X 482118..482433 63..378 100 -> Plus
X 482518..482658 379..519 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:15 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
X 481936..481997 1..62 98 -> Plus
X 482118..482433 63..378 100 -> Plus
X 482518..482658 379..519 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:36:15 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
X 481936..481997 1..62 98 -> Plus
X 482118..482433 63..378 100 -> Plus
X 482518..482658 379..519 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:16:26 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 375969..376030 1..62 98 -> Plus
arm_X 376151..376466 63..378 100 -> Plus
arm_X 376551..376691 379..519 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:36 Download gff for RH59219.complete
Subject Subject Range Query Range Percent Splice Strand
X 490216..490531 63..378 100 -> Plus
X 490616..490756 379..519 99   Plus
X 490034..490095 1..62 98 -> Plus

RH59219.hyp Sequence

Translation from 0 to 383

> RH59219.hyp
HCNLEILRVLIALLADLKQIKEDNQNAFRWRNRQWARSGPEYPESIGARP
GGARPMRAVLSAGRWFHHSAQPFHRLVESAPEIALLPAPNTHPRHMRQLR
DGSLRGVWLLLRRVRQVYLPQLRDFIW*
Sequence RH59219.hyp has no blast hits.

RH59219.pep Sequence

Translation from 76 to 441

> RH59219.pep
MLFDGETGNGQGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEDPLCEHCQMFLS*

RH59219.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21455-PA 230 GF21455-PA 136..230 30..121 360 70.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12788-PA 389 GG12788-PA 285..389 20..121 430 76.2 Plus
Dere\GG12787-PA 121 GG12787-PA 17..121 20..121 413 76.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24415-PA 114 GH24415-PA 3..114 13..121 304 56.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3176-PD 121 CG3176-PD 1..121 1..121 683 100 Plus
CG3176-PA 121 CG3176-PA 1..121 1..121 683 100 Plus
CG32817-PB 121 CG32817-PB 1..121 1..121 664 97.5 Plus
CG32817-PC 121 CG32817-PC 1..121 1..121 664 97.5 Plus
CG32817-PA 121 CG32817-PA 1..121 1..121 664 97.5 Plus
CG3176-PC 101 CG3176-PC 1..100 1..100 564 100 Plus
CG3176-PB 101 CG3176-PB 1..100 1..100 564 100 Plus
CG13373-PA 124 CG13373-PA 1..124 1..121 557 81.5 Plus
CG13373-PB 177 CG13373-PB 54..177 1..121 557 81.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16312-PA 176 GI16312-PA 50..176 1..121 324 54.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20383-PA 78 GL20383-PA 2..78 48..121 247 63.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12237-PA 143 GA12237-PA 27..141 4..119 292 52.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16244-PA 122 GM16244-PA 1..122 1..121 537 86.9 Plus
Dsec\GM16243-PA 122 GM16243-PA 1..122 1..121 537 86.9 Plus
Dsec\GM19067-PA 122 GM19067-PA 1..122 1..121 537 86.9 Plus
Dsec\GM19066-PA 234 GM19066-PA 54..157 1..101 440 79.8 Plus
Dsec\GM23227-PA 104 GM23227-PA 1..96 1..95 417 86.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16505-PA 177 GD16505-PA 54..177 1..121 532 79.8 Plus
Dsim\GD16506-PA 122 GD16506-PA 1..122 1..121 488 82.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15649-PA 207 GJ15649-PA 113..207 30..121 331 67.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15991-PA 180 GK15991-PA 50..178 1..119 316 53.5 Plus
Dwil\GK15987-PA 158 GK15987-PA 59..158 28..121 280 61 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16613-PA 324 GE16613-PA 226..324 26..121 398 74.7 Plus