Clone RH59280 Report

Search the DGRC for RH59280

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:592
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG32726-RA
Protein status:RH59280.pep: gold
Preliminary Size:219
Sequenced Size:475

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15036 2002-01-01 Sim4 clustering to Release 2
CG32726 2003-01-01 Sim4 clustering to Release 3
CG32726 2008-04-29 Release 5.5 accounting
CG32726 2008-08-15 Release 5.9 accounting
CG32726 2008-12-18 5.12 accounting

Clone Sequence Records

RH59280.complete Sequence

475 bp (475 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113607

> RH59280.complete
GAATCATTCCACATCAAGATGCGTTTCTGTCTACTGTTCCTTTTGGCCAT
GAGCTGCTGTCTGCTGCAATTCTCCGTGGCTGGAGTGAATTTGGTGCGCG
GACTGGAGGCTGCCGGTCATCATCGCAACTTCACCGGCTCACCACCACCG
CGTGGTGCTCCTCCACCACCTCGGACCACCACCGCCAGTTCTTCGGGTTA
AATAAATTGAAAGCAAAACACGAGAAAACTGGCAAAATTTCCATTGACGG
ACGATTTAAATGAAACCTACCATTATGTAATCCTATAGCTTCAAAAAATA
TAGAAAAACCATTCCAGCAAAAAAAAAAAAAAAATAGTTCCAGTGTTTTA
AACCACAGTTTTAGTAAATATTCGTTTTTATTTATTCGTAATTGGCAATA
TATCTATCTTATCTCGTTTTAAGATACTGAAATGAATTCATTGAAATATA
AAATTCTACAAAAAAAAAAAAAAAA

RH59280.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-RA 477 CG32726-RA 24..477 2..455 2270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7317151..7317544 459..66 1970 100 Minus
chrX 22417052 chrX 7317610..7317674 66..2 325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7425219..7425613 460..66 1975 100 Minus
X 23542271 X 7425679..7425743 66..2 325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7433317..7433711 460..66 1975 100 Minus
X 23527363 X 7433777..7433841 66..2 325 100 Minus
Blast to na_te.dros performed 2019-03-15 14:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 2058..2117 195..256 124 71 Plus
Dtei\I-element 5386 Dtei\I-element DTEII 5386bp 4086..4216 207..334 107 55.7 Plus

RH59280.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:36:13 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7317151..7317543 67..459 100 <- Minus
chrX 7317610..7317674 1..66 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:53 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..183 19..201 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:11 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..183 19..201 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:43 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..183 19..201 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:09:40 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..183 19..201 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..183 19..201 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:06:35 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..454 2..455 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:11 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..458 2..459 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:43 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..458 2..459 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:09:43 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..454 2..455 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 1..458 2..459 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425220..7425612 67..459 100 <- Minus
X 7425679..7425743 1..66 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425220..7425612 67..459 100 <- Minus
X 7425679..7425743 1..66 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425220..7425612 67..459 100 <- Minus
X 7425679..7425743 1..66 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:43 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7319253..7319645 67..459 100 <- Minus
arm_X 7319712..7319776 1..66 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:03 Download gff for RH59280.complete
Subject Subject Range Query Range Percent Splice Strand
X 7433318..7433710 67..459 100 <- Minus
X 7433777..7433841 1..66 98   Minus

RH59280.hyp Sequence

Translation from 2 to 262

> RH59280.hyp
IIPHQDAFLSTVPFGHELLSAAILRGWSEFGARTGGCRSSSQLHRLTTTA
WCSSTTSDHHRQFFGLNKLKAKHEKTGKISIDGRFK*
Sequence RH59280.hyp has no blast hits.

RH59280.pep Sequence

Translation from 18 to 200

> RH59280.pep
MRFCLLFLLAMSCCLLQFSVAGVNLVRGLEAAGHHRNFTGSPPPRGAPPP
PRTTTASSSG*

RH59280.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17620-PA 60 GG17620-PA 1..60 1..60 212 88.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-PB 60 CG32726-PB 1..60 1..60 321 100 Plus
CG32726-PA 60 CG32726-PA 1..60 1..60 321 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17467-PA 386 GM17467-PA 343..386 17..60 151 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16153-PA 60 GD16153-PA 1..60 1..60 224 95 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17522-PA 60 GE17522-PA 1..60 1..60 189 85 Plus