Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
RH59280.complete Sequence
475 bp (475 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113607
> RH59280.complete
GAATCATTCCACATCAAGATGCGTTTCTGTCTACTGTTCCTTTTGGCCAT
GAGCTGCTGTCTGCTGCAATTCTCCGTGGCTGGAGTGAATTTGGTGCGCG
GACTGGAGGCTGCCGGTCATCATCGCAACTTCACCGGCTCACCACCACCG
CGTGGTGCTCCTCCACCACCTCGGACCACCACCGCCAGTTCTTCGGGTTA
AATAAATTGAAAGCAAAACACGAGAAAACTGGCAAAATTTCCATTGACGG
ACGATTTAAATGAAACCTACCATTATGTAATCCTATAGCTTCAAAAAATA
TAGAAAAACCATTCCAGCAAAAAAAAAAAAAAAATAGTTCCAGTGTTTTA
AACCACAGTTTTAGTAAATATTCGTTTTTATTTATTCGTAATTGGCAATA
TATCTATCTTATCTCGTTTTAAGATACTGAAATGAATTCATTGAAATATA
AAATTCTACAAAAAAAAAAAAAAAA
RH59280.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:20:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32726-RA | 477 | CG32726-RA | 24..477 | 2..455 | 2270 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:35:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 7317151..7317544 | 459..66 | 1970 | 100 | Minus |
chrX | 22417052 | chrX | 7317610..7317674 | 66..2 | 325 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:35:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7425219..7425613 | 460..66 | 1975 | 100 | Minus |
X | 23542271 | X | 7425679..7425743 | 66..2 | 325 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 7433317..7433711 | 460..66 | 1975 | 100 | Minus |
X | 23527363 | X | 7433777..7433841 | 66..2 | 325 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 14:35:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ivk | 5402 | Ivk IVK 5402bp | 2058..2117 | 195..256 | 124 | 71 | Plus |
Dtei\I-element | 5386 | Dtei\I-element DTEII 5386bp | 4086..4216 | 207..334 | 107 | 55.7 | Plus |
RH59280.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:36:13 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 7317151..7317543 | 67..459 | 100 | <- | Minus |
chrX | 7317610..7317674 | 1..66 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:53 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..183 | 19..201 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:35:11 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..183 | 19..201 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:36:43 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..183 | 19..201 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:09:40 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..183 | 19..201 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..183 | 19..201 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:06:35 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..454 | 2..455 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:35:11 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..458 | 2..459 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:36:43 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..458 | 2..459 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:09:43 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..454 | 2..455 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:04:24 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 1..458 | 2..459 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7425220..7425612 | 67..459 | 100 | <- | Minus |
X | 7425679..7425743 | 1..66 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7425220..7425612 | 67..459 | 100 | <- | Minus |
X | 7425679..7425743 | 1..66 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:36:13 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7425220..7425612 | 67..459 | 100 | <- | Minus |
X | 7425679..7425743 | 1..66 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:36:43 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7319253..7319645 | 67..459 | 100 | <- | Minus |
arm_X | 7319712..7319776 | 1..66 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:03 Download gff for
RH59280.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7433318..7433710 | 67..459 | 100 | <- | Minus |
X | 7433777..7433841 | 1..66 | 98 | | Minus |
RH59280.hyp Sequence
Translation from 2 to 262
> RH59280.hyp
IIPHQDAFLSTVPFGHELLSAAILRGWSEFGARTGGCRSSSQLHRLTTTA
WCSSTTSDHHRQFFGLNKLKAKHEKTGKISIDGRFK*
Sequence RH59280.hyp has no blast hits.
RH59280.pep Sequence
Translation from 18 to 200
> RH59280.pep
MRFCLLFLLAMSCCLLQFSVAGVNLVRGLEAAGHHRNFTGSPPPRGAPPP
PRTTTASSSG*
RH59280.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:47:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17620-PA | 60 | GG17620-PA | 1..60 | 1..60 | 212 | 88.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32726-PB | 60 | CG32726-PB | 1..60 | 1..60 | 321 | 100 | Plus |
CG32726-PA | 60 | CG32726-PA | 1..60 | 1..60 | 321 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:47:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17467-PA | 386 | GM17467-PA | 343..386 | 17..60 | 151 | 97.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:47:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16153-PA | 60 | GD16153-PA | 1..60 | 1..60 | 224 | 95 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:48:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17522-PA | 60 | GE17522-PA | 1..60 | 1..60 | 189 | 85 | Plus |