Clone RH59553 Report

Search the DGRC for RH59553

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:595
Well:53
Vector:pFlc-1
Associated Gene/TranscriptMgstl-RB
Protein status:RH59553.pep: gold
Preliminary Size:649
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1742 2001-12-17 Blastp of sequenced clone
CG1742 2002-01-01 Sim4 clustering to Release 2
CG1742 2003-01-01 Sim4 clustering to Release 3
Mgstl 2008-04-29 Release 5.5 accounting
Mgstl 2008-08-15 Release 5.9 accounting
Mgstl 2008-12-18 5.12 accounting

Clone Sequence Records

RH59553.complete Sequence

602 bp (602 high quality bases) assembled on 2001-12-17

GenBank Submission: AY071752

> RH59553.complete
GAGTATGCAAGTGCACCTGCAGCTATCAAAATGCTTAACCCCGAACTCAT
GTCGCTGGAGAACCAGGTGTTCCGATGCTACCTGGGATGGTCGGCTATAT
TGATACTCAAGATCTTCGCCGCTGGTATTTACACGGGTCTCATGCGCTTC
TTTACGGCCACCTTCGCCAACCCCGAGGACCTGATGTCCCCCAAGCTGAA
GGTCAAGTTCGACGATCCGAACGTGGAGCGTGTGCGCCGTGCCCACCGCA
ACGACCTGGAGAACATCCTGCCCTTCTTCGCCATCGGTCTGCTCTACGTC
CTGACTGATCCGGCCGCCTTTCTGGCCATCAACCTGTTCCGCGCCGTGGG
CATCGCCCGCATCGTCCACACACTGGTCTACGCCGTGGTCGTGGTGCCCC
AGCCTTCCCGTGCCCTCGCCTTCTTCGTGGCCTTGGGCGCCACCGTCTAC
ATGGCCCTGCAGGTCATCGCCTCGGCCGCCTTCTGAGCACATAGGTCTAG
TCCTTCTTGTTTTTTTTTTTAAGCATTTTGAAATAATTTCTGAAATATAG
AGTTACGCCTACCTCGGCTTTGGTGCTGTTGGATCACAAAAAAAAAAAAA
AA

RH59553.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:52
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-RB 659 Mgstl-RB 36..623 2..589 2940 100 Plus
Mgstl-RA 711 Mgstl-RA 244..673 160..589 2150 100 Plus
Mgstl.b 894 Mgstl.b 244..673 160..589 2150 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20908837..20909264 160..587 2140 100 Plus
chr2L 23010047 chr2L 22224876..22225302 160..587 1910 97 Plus
chrX 22417052 chrX 20907647..20907804 2..159 790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
CR12628-RA 621 CR12628-RA 195..621 160..587 1920 96.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21043680..21044109 160..589 2150 100 Plus
2L 23513712 2L 22226345..22226782 160..598 1965 97 Plus
X 23542271 X 21042490..21042647 2..159 790 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21028772..21029201 160..589 2150 100 Plus
2L 23513712 2L 22226345..22226782 160..598 1975 97 Plus
X 23527363 X 21027582..21027739 2..159 790 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:12:23 has no hits.

RH59553.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:13:28 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20907646..20907804 1..159 99 -> Plus
chrX 20908837..20909264 160..587 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:50:57 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 1..456 31..486 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:15 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 1..456 31..486 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:07:25 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 1..456 31..486 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:48 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 1..456 31..486 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:58:55 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 1..456 31..486 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 21:35:11 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
CR12628-RA 189..621 154..587 96   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:31 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 2..587 2..587 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:14 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 2..587 2..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:07:25 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 5..591 1..587 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:48 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 2..587 2..587 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:58:55 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
Mgstl-RB 5..591 1..587 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:28 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
X 21042489..21042647 1..159 99 -> Plus
X 21043680..21044107 160..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:28 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
X 21042489..21042647 1..159 99 -> Plus
X 21043680..21044107 160..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:28 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
X 21042489..21042647 1..159 99 -> Plus
X 21043680..21044107 160..587 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:07:25 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20913516..20913674 1..159 99 -> Plus
arm_X 20914707..20915134 160..587 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:40 Download gff for RH59553.complete
Subject Subject Range Query Range Percent Splice Strand
X 21028772..21029199 160..587 100   Plus
X 21027581..21027739 1..159 99 -> Plus

RH59553.hyp Sequence

Translation from 0 to 485

> RH59553.hyp
QYASAPAAIKMLNPELMSLENQVFRCYLGWSAILILKIFAAGIYTGLMRF
FTATFANPEDLMSPKLKVKFDDPNVERVRRAHRNDLENILPFFAIGLLYV
LTDPAAFLAINLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVALGATVY
MALQVIASAAF*

RH59553.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PC 151 CG1742-PC 1..151 11..161 757 100 Plus
Mgstl-PB 151 CG1742-PB 1..151 11..161 757 100 Plus
Mgstl-PA 152 CG1742-PA 6..152 15..161 614 83 Plus
CG33178-PC 165 CG33178-PC 3..157 3..155 395 52.3 Plus
CG33178-PA 165 CG33178-PA 3..157 3..155 395 52.3 Plus

RH59553.pep Sequence

Translation from 30 to 485

> RH59553.pep
MLNPELMSLENQVFRCYLGWSAILILKIFAAGIYTGLMRFFTATFANPED
LMSPKLKVKFDDPNVERVRRAHRNDLENILPFFAIGLLYVLTDPAAFLAI
NLFRAVGIARIVHTLVYAVVVVPQPSRALAFFVALGATVYMALQVIASAA
F*

RH59553.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21709-PA 195 GF21709-PA 1..195 1..151 672 70.3 Plus
Dana\GF21219-PA 170 GF21219-PA 22..159 5..142 398 55.8 Plus
Dana\GF21218-PA 170 GF21218-PA 22..159 6..142 357 51.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19704-PA 195 GG19704-PA 1..195 1..151 709 74.9 Plus
Dere\GG17862-PA 165 GG17862-PA 12..154 1..142 398 54.5 Plus
Dere\GG17861-PA 167 GG17861-PA 19..156 6..142 349 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12207-PA 191 GH12207-PA 1..191 1..151 603 64.4 Plus
Dgri\GH24641-PA 162 GH24641-PA 2..151 5..142 397 53.3 Plus
Dgri\GH24640-PA 167 GH24640-PA 18..160 5..146 345 49.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Mgstl-PC 151 CG1742-PC 1..151 1..151 757 100 Plus
Mgstl-PB 151 CG1742-PB 1..151 1..151 757 100 Plus
Mgstl-PA 152 CG1742-PA 6..152 5..151 614 83 Plus
CG33178-PC 165 CG33178-PC 17..157 5..145 392 54.6 Plus
CG33178-PA 165 CG33178-PA 17..157 5..145 392 54.6 Plus
CG33178-PB 177 CG33178-PB 17..169 5..145 370 50.3 Plus
CG33177-PA 167 CG33177-PA 19..160 6..146 352 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15739-PA 150 GI15739-PA 4..150 5..151 595 76.2 Plus
Dmoj\GI21688-PA 177 GI21688-PA 15..166 3..142 392 52 Plus
Dmoj\GI21687-PA 159 GI21687-PA 11..155 6..149 353 48.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16397-PA 195 GL16397-PA 1..195 1..151 634 66.2 Plus
Dper\GL15178-PA 163 GL15178-PA 15..152 5..142 392 54.3 Plus
Dper\GL15177-PA 166 GL15177-PA 18..162 6..149 356 50.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14506-PA 195 GA14506-PA 1..195 1..151 634 66.2 Plus
Dpse\GA22801-PA 163 GA22801-PA 15..152 5..142 392 54.3 Plus
Dpse\GA22800-PA 166 GA22800-PA 18..162 6..149 358 50.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23058-PA 195 GM23058-PA 1..195 1..151 724 76.9 Plus
Dsec\GM12056-PA 165 GM12056-PA 12..154 1..142 399 54.5 Plus
Dsec\GM12055-PA 167 GM12055-PA 19..156 6..142 353 50.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17510-PA 195 GD17510-PA 1..195 1..151 717 75.9 Plus
Dsim\GD17192-PA 165 GD17192-PA 12..154 1..142 399 54.5 Plus
Dsim\GD17191-PA 167 GD17191-PA 19..156 6..142 353 50.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18600-PA 191 GJ18600-PA 1..191 1..151 598 63.9 Plus
Dvir\GJ15869-PA 162 GJ15869-PA 2..151 5..142 386 52 Plus
Dvir\GJ15868-PA 165 GJ15868-PA 15..161 4..149 369 50.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25033-PA 152 GK25033-PA 6..152 5..151 563 70.1 Plus
Dwil\GK16260-PA 185 GK16260-PA 21..174 1..142 381 50.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17903-PA 195 GE17903-PA 1..195 1..151 633 71.8 Plus
Dyak\GE17164-PA 165 GE17164-PA 12..154 1..142 398 54.5 Plus
Dyak\GE17163-PA 167 GE17163-PA 19..156 6..142 352 49.3 Plus