Clone RH61147 Report

Search the DGRC for RH61147

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:611
Well:47
Vector:pFlc-1
Associated Gene/TranscriptAcp65Aa-RA
Protein status:RH61147.pep: gold
Preliminary Size:306
Sequenced Size:631

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10297 2002-01-01 Sim4 clustering to Release 2
CG10297 2002-04-21 Blastp of sequenced clone
CG10297 2003-01-01 Sim4 clustering to Release 3
Acp65Aa 2008-04-29 Release 5.5 accounting
Acp65Aa 2008-08-15 Release 5.9 accounting
Acp65Aa 2008-12-18 5.12 accounting

Clone Sequence Records

RH61147.complete Sequence

631 bp (631 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113609

> RH61147.complete
GACCATTAGACAACTGCCAGTTTGTCCAGCCGCATAGGAGAATCTGCAAT
TTCGAGAACCGCTCAACATGATGAAATTGATGCTAGTCGTTGGCTCGATA
GCCCTTCTCCTGGCCCTGGCCAGTGCCCGGCCGCAAAATGATGTGGAAGT
TCTTGAGTACGAATCGGAGAACACCGGCCTCGGCGGCTACAAGTTCAGCT
ACAAACTGAGCGATGGCACCAGTCGAACAGAGGAGGGCGTGGTCAACAAC
GCGGGCACCGACAACGAATCCATATCCATTCGGGGATCCGTCACCTGGGT
GGCTCCCGATGGCCAAACCTACACCATTAACTTTGTGGCCGACGAGAACG
GTTTTCAGCCGGAGGGTGCCCATCTGCCCAAGTAGACCTCCGCTTTCGAG
GAGATCCTGTAAATACCACCTTCCCGAATGAACCCACAATTCCAACCAAC
CAGCCATACAGTGAGGTGCTAAGGTCCTGTCCGGAGGAGCTGTCCCTTGT
CCCGTGGCAGCCAATCGGTCAGTCAGTTAGTAAGTCGATCAGTCAGTCAA
GTCAGTGTCGTGCATTGTTTTCTATTTTCCTTGTTACTCGCATTAAAGCC
GAACTTTCGATTCTCGAAAAAAAAAAAAAAA

RH61147.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:14
Subject Length Description Subject Range Query Range Score Percent Strand
Acp65Aa-RA 899 Acp65Aa-RA 182..803 2..623 3110 100 Plus
Cpr65Av-RA 973 Cpr65Av-RA 654..746 287..379 195 80.6 Plus
Cpr65Av.a 1255 Cpr65Av.a 347..439 287..379 195 80.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6144601..6145138 616..79 2675 99.8 Minus
chr3L 24539361 chr3L 6145219..6145296 79..2 375 98.7 Minus
chr3L 24539361 chr3L 6131974..6132066 379..287 195 80.6 Minus
chr3L 24539361 chr3L 6136348..6136421 307..380 190 83.8 Plus
chr3L 24539361 chr3L 6137767..6137840 308..381 190 83.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6152043..6152587 623..79 2725 100 Minus
3L 28110227 3L 6152668..6152745 79..2 390 100 Minus
3L 28110227 3L 6139425..6139517 379..287 195 80.6 Minus
3L 28110227 3L 6143799..6143872 307..380 190 83.8 Plus
3L 28110227 3L 6145218..6145291 308..381 190 83.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6145143..6145687 623..79 2725 100 Minus
3L 28103327 3L 6145768..6145845 79..2 390 100 Minus
3L 28103327 3L 6132525..6132617 379..287 195 80.6 Minus
3L 28103327 3L 6138318..6138391 308..381 190 83.7 Plus
3L 28103327 3L 6136899..6136972 307..380 190 83.7 Plus
Blast to na_te.dros performed on 2019-03-16 05:12:34 has no hits.

RH61147.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:13:33 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6145219..6145296 1..79 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:09 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..318 68..385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:07 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..318 68..385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:07:35 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..318 68..385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:28:52 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..318 68..385 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:59:08 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..318 68..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:48:59 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:07 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:07:35 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:28:52 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..615 2..616 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:59:08 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
Acp65Aa-RA 1..615 2..616 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:33 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6152050..6152586 80..616 100 <- Minus
3L 6152668..6152745 1..79 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:33 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6152050..6152586 80..616 100 <- Minus
3L 6152668..6152745 1..79 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:13:33 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6152050..6152586 80..616 100 <- Minus
3L 6152668..6152745 1..79 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:07:35 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6145150..6145686 80..616 100 <- Minus
arm_3L 6145768..6145845 1..79 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:21 Download gff for RH61147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6145150..6145686 80..616 100 <- Minus
3L 6145768..6145845 1..79 98   Minus

RH61147.pep Sequence

Translation from 67 to 384

> RH61147.pep
MMKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPK*

RH61147.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10917-PA 104 GF10917-PA 1..104 1..105 429 85.7 Plus
Dana\GF10920-PA 111 GF10920-PA 7..110 4..105 293 50.5 Plus
Dana\GF23520-PA 108 GF23520-PA 1..105 2..105 254 50 Plus
Dana\GF10923-PA 105 GF10923-PA 24..100 27..104 247 57.7 Plus
Dana\GF10918-PA 105 GF10918-PA 1..100 2..104 234 49.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:41:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14078-PA 105 GG14078-PA 1..105 1..105 545 99 Plus
Dere\GG14081-PA 111 GG14081-PA 15..110 13..105 291 52.1 Plus
Dere\GG15325-PA 108 GG15325-PA 1..105 2..105 273 52.3 Plus
Dere\GG14080-PA 108 GG14080-PA 8..105 11..105 244 46.9 Plus
Dere\GG14079-PA 106 GG14079-PA 37..101 40..104 233 60 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15647-PA 105 GH15647-PA 1..105 1..105 469 81 Plus
Dgri\GH15837-PA 104 GH15837-PA 1..103 2..105 295 51.9 Plus
Dgri\GH15653-PA 114 GH15653-PA 23..113 18..105 277 52.7 Plus
Dgri\GH15650-PA 101 GH15650-PA 1..98 2..105 273 53.8 Plus
Dgri\GH13967-PA 99 GH13967-PA 1..98 2..105 271 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:24
Subject Length Description Subject Range Query Range Score Percent Strand
Acp65Aa-PA 105 CG10297-PA 1..105 1..105 536 100 Plus
Cpr65Av-PA 111 CG32405-PA 8..109 5..104 293 52.4 Plus
Cpr65Ax2-PB 102 CG18777-PB 10..97 14..104 264 58.2 Plus
Cpr65Ax2-PA 102 CG18777-PA 10..97 14..104 264 58.2 Plus
Cpr65Ax1-PA 102 CG34270-PA 10..97 14..104 264 58.2 Plus
Cpr65Aw-PA 117 CG32404-PA 1..105 1..105 250 44.8 Plus
Lcp65Ad-PB 108 CG6955-PB 1..105 2..105 247 47.2 Plus
Lcp65Ad-PA 108 CG6955-PA 1..105 2..105 247 47.2 Plus
Lcp65Ac-PA 109 CG6956-PA 7..103 7..104 247 48 Plus
Lcp65Ag3-PA 105 CG18779-PA 1..100 2..104 223 41.7 Plus
Lcp65Ag2-PA 105 CG10534-PA 1..100 2..104 220 40.8 Plus
Lcp65Ag1-PA 105 CG10530-PA 1..100 2..104 220 40.8 Plus
Lcp65Af-PA 100 CG10533-PA 1..95 2..104 219 44.7 Plus
Lcp65Ae-PA 99 CG10529-PA 1..96 2..104 208 41.7 Plus
Lcp65Ab1-PA 104 CG32400-PA 1..99 2..104 202 46.2 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..99 2..104 202 46.2 Plus
Cpr49Aa-PB 144 CG30045-PB 10..109 12..104 202 42 Plus
Lcp65Aa-PA 102 CG7287-PA 1..100 2..104 196 36.9 Plus
Cpr65Au-PB 106 CG18778-PB 6..101 5..99 190 44.3 Plus
Cpr65Au-PA 106 CG18778-PA 6..101 5..99 190 44.3 Plus
Cpr65Aw-PB 86 CG32404-PB 14..74 45..105 186 54.1 Plus
Cpr47Ef-PD 601 CG13214-PD 134..212 26..104 185 43 Plus
Cpr47Ef-PC 612 CG13214-PC 134..212 26..104 185 43 Plus
Cpr78E-PA 137 CG7160-PA 1..112 1..105 183 39.3 Plus
Cpr49Af-PB 126 CG8510-PB 7..98 11..104 176 38.3 Plus
Cpr49Af-PA 126 CG8510-PA 7..98 11..104 176 38.3 Plus
Cpr47Eb-PA 214 CG13224-PA 9..112 4..105 171 33.7 Plus
Cpr65Az-PA 239 CG12330-PA 113..193 25..104 168 37 Plus
Cpr47Ea-PA 135 CG9079-PA 54..119 39..104 167 42.4 Plus
Cpr49Ae-PA 134 CG8505-PA 13..109 14..104 155 36.1 Plus
Cpr67Fb-PA 122 CG18348-PA 1..94 1..104 152 33.7 Plus
Cpr47Ee-PA 369 CG13222-PA 102..185 23..104 151 35.7 Plus
Cpr11B-PB 195 CG2555-PB 67..147 21..104 150 36.9 Plus
Cpr11B-PA 197 CG2555-PA 67..147 21..104 150 36.9 Plus
Cpr78Cc-PA 119 CG7658-PA 1..96 1..104 143 36.8 Plus
Cpr67Fa2-PA 134 CG18349-PA 1..97 1..104 140 30.5 Plus
Cpr67Fa1-PA 134 CG7941-PA 1..97 1..104 138 30.5 Plus
Cpr49Ag-PA 134 CG8511-PA 1..130 1..104 136 32.1 Plus
Pcp-PA 184 CG3440-PA 34..101 23..105 135 32.5 Plus
Cpr47Ec-PA 131 CG9077-PA 10..103 11..101 134 33.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12694-PA 101 GI12694-PA 14..101 18..105 426 85.2 Plus
Dmoj\GI12698-PA 111 GI12698-PA 1..110 5..105 295 51.8 Plus
Dmoj\GI12620-PA 104 GI12620-PA 1..103 2..105 273 46.2 Plus
Dmoj\GI12618-PA 110 GI12618-PA 26..104 25..104 262 61.3 Plus
Dmoj\GI12628-PA 104 GI12628-PA 1..102 2..104 245 42.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15515-PA 111 GL15515-PA 4..110 2..105 299 49.5 Plus
Dper\GL15514-PA 120 GL15514-PA 6..113 4..105 248 42.6 Plus
Dper\GL15521-PA 102 GL15521-PA 1..99 2..104 234 52.4 Plus
Dper\GL15557-PA 109 GL15557-PA 39..103 40..104 229 61.5 Plus
Dper\GL15560-PA 102 GL15560-PA 1..100 2..104 225 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10226-PA 135 GA10226-PA 36..135 5..105 470 88.1 Plus
Dpse\GA16877-PA 111 GA16877-PA 4..110 2..105 299 49.5 Plus
Dpse\GA16876-PA 120 GA16876-PA 9..113 7..105 245 42.9 Plus
Dpse\GA19982-PA 109 GA19982-PA 39..103 40..104 229 61.5 Plus
Dpse\GA20238-PA 102 GA20238-PA 1..100 5..104 220 40.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13861-PA 105 GM13861-PA 1..105 1..105 544 98.1 Plus
Dsec\GM13864-PA 111 GM13864-PA 7..110 4..105 298 50.5 Plus
Dsec\GM13863-PA 108 GM13863-PA 1..105 1..105 252 43.8 Plus
Dsec\GM14759-PA 108 GM14759-PA 24..105 23..105 243 54.2 Plus
Dsec\GM11071-PA 115 GM11071-PA 24..105 23..105 238 54.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13144-PA 105 GD13144-PA 1..105 1..105 544 98.1 Plus
Dsim\GD13147-PA 111 GD13147-PA 7..110 4..105 298 50.5 Plus
Dsim\GD13938-PA 108 GD13938-PA 24..105 23..105 243 54.2 Plus
Dsim\GD13146-PA 108 GD13146-PA 1..105 1..105 243 42.9 Plus
Dsim\GD13939-PA 107 GD13939-PA 20..101 22..104 238 54.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Acp65A-PA 105 GJ12679-PA 1..105 1..105 447 80 Plus
Dvir\GJ12683-PA 111 GJ12683-PA 15..110 13..105 298 54.2 Plus
Dvir\GJ12742-PA 102 GJ12742-PA 1..101 2..105 275 48.1 Plus
Dvir\GJ12738-PA 110 GJ12738-PA 13..107 10..105 255 47.9 Plus
Dvir\GJ12682-PA 111 GJ12682-PA 1..104 5..105 252 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16917-PA 107 GK16917-PA 1..107 1..105 479 85 Plus
Dwil\GK16920-PA 111 GK16920-PA 15..110 13..105 282 51 Plus
Dwil\GK17269-PA 108 GK17269-PA 1..102 2..104 259 49.5 Plus
Dwil\GK17266-PA 115 GK17266-PA 12..112 4..105 259 47.1 Plus
Dwil\GK16921-PA 105 GK16921-PA 1..100 2..104 258 49.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20502-PA 195 GE20502-PA 1..104 1..104 531 97.1 Plus
Dyak\GE20507-PA 111 GE20507-PA 7..110 4..105 291 48.6 Plus
Dyak\GE20506-PA 108 GE20506-PA 1..105 1..105 252 43.8 Plus
Dyak\GE21543-PA 108 GE21543-PA 24..105 23..105 243 53 Plus
Dyak\GE21545-PA 104 GE21545-PA 1..99 2..104 218 48.1 Plus
Dyak\GE20502-PA 195 GE20502-PA 130..193 41..104 162 50.8 Plus

RH61147.hyp Sequence

Translation from 67 to 384

> RH61147.hyp
MMKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPK*

RH61147.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Acp65Aa-PA 105 CG10297-PA 1..105 1..105 536 100 Plus
Cpr65Av-PA 111 CG32405-PA 8..109 5..104 293 52.4 Plus
Cpr65Ax1-PA 102 CG34270-PA 10..97 14..104 264 58.2 Plus
Cpr65Ax2-PB 102 CG18777-PB 10..97 14..104 264 58.2 Plus
Cpr65Ax2-PA 102 CG18777-PA 10..97 14..104 264 58.2 Plus