BDGP Sequence Production Resources |
Search the DGRC for RH61560
Library: | RH |
Tissue Source: | Drosophila melanogaster adult head |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2001-04-30 |
Comments: | Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 615 |
Well: | 60 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Vhl-RA |
Protein status: | RH61560.pep: gold |
Preliminary Size: | 537 |
Sequenced Size: | 961 |
Gene | Date | Evidence |
---|---|---|
CG13221 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13221 | 2002-01-03 | Blastp of sequenced clone |
CG13221 | 2003-01-01 | Sim4 clustering to Release 3 |
Vhl | 2008-04-29 | Release 5.5 accounting |
Vhl | 2008-08-15 | Release 5.9 accounting |
Vhl | 2008-12-18 | 5.12 accounting |
961 bp (961 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075555
> RH61560.complete CACCACCGTAACTGATAAGAAGTGAATTTTATCTATACTTGTTGTTAGCT TGTTGTGATTTGATTCAATCCAATTCCCACGGCTTGTGCAAACGTAAAAC AACGAAAATTGATTTGGCAGCCATTGCAGATCGGCTTAGCACCCTGCTGG AGATGGCGCTCCAAATAGCGCAGAACAACCGCGACGGCCAGCAGCTGGTG GGCGCTGATCAGGGAAAGGTGGAGGTGTACGTGCTGTTTGCAAACACCAC CTATCGCACCCTGGATCTGTACTGGGTGTGCGAGCGGGAGCGGGAGAACA TGTACCTTACCCTCAAGCCCTTCGAGGAGGTGCGGGTGAACACGTTCACC ACACACAGCTGGCTGTTCCGGGATTACTACACGGGCGAACGGATGCACGT ACGCTCGCAGAGGATCTTTCAGCCGATTCGGGTGCGGGTACCCAAGAGCC AGCAGAGTCCGGATCAGCTGGTTGACGTACGCAGCGAAGTGCTGATCCAC TTTCCGATGAGATCGCTGCGCGAAAACTGCCTCTGGCTGGTCGCCCGCTG GCTGATCCGGACGAGCAACGCGCCACGGAGGATTATCCACGGATACCACA TACCCTCGACGCTGAAGCAACAGCTGCTCAGCCTGCTGACCTGCATCGAG TCCTATTCCCGAGTGGCGGGCACGCGACGTCGGCGTTAGGAGCACACTCC TAGTTGTTAGTTAAGAGGGCGGGTAATCATCTTAGGGACTGAGAGACAGG CTTGATTTCCAAATAATTTAATAACTTTAATTGATTTCCATCCTGGTTTT CGATTTTCGCTTATTACTTATGTACAAATTGGCTTGCATAGAGCTCTTTA CAAGTTGGGCTACTACCATTGCATTGATTTTTCTGTATATTTAACAGATT TCTTATACCTATGTATGTTCTATGTAAATAATTATGTATAAACCCAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 7167182..7168121 | 5..944 | 4700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 11279730..11280669 | 5..944 | 4700 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 11280929..11281868 | 5..944 | 4700 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7167178..7168121 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..537 | 153..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..537 | 153..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..537 | 153..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..537 | 153..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..537 | 153..689 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 5..944 | 5..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 5..944 | 5..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..945 | 2..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 5..944 | 5..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Vhl-RA | 1..945 | 2..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11279726..11280669 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11279726..11280669 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11279726..11280669 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7167231..7168174 | 1..945 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11280925..11281868 | 1..945 | 99 | Plus |
Translation from 152 to 688
> RH61560.pep MALQIAQNNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENM YLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQ QSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHI PSTLKQQLLSLLTCIESYSRVAGTRRRR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12540-PA | 175 | GF12540-PA | 1..175 | 1..178 | 699 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20185-PA | 178 | GG20185-PA | 1..178 | 1..178 | 933 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19949-PA | 192 | GH19949-PA | 1..172 | 1..170 | 436 | 48.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Vhl-PB | 178 | CG13221-PB | 1..178 | 1..178 | 935 | 100 | Plus |
Vhl-PA | 178 | CG13221-PA | 1..178 | 1..178 | 935 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19906-PA | 184 | GI19906-PA | 1..179 | 1..178 | 525 | 61.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17723-PA | 188 | GL17723-PA | 1..171 | 1..169 | 618 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12133-PA | 188 | GA12133-PA | 1..171 | 1..169 | 618 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21273-PA | 178 | GM21273-PA | 1..178 | 1..178 | 934 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10785-PA | 178 | GD10785-PA | 1..178 | 1..178 | 939 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15074-PA | 184 | GJ15074-PA | 1..174 | 1..173 | 571 | 62.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21683-PA | 195 | GK21683-PA | 25..187 | 12..176 | 615 | 67.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12873-PA | 178 | GE12873-PA | 1..178 | 1..178 | 934 | 98.3 | Plus |
Translation from 152 to 688
> RH61560.hyp MALQIAQNNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENM YLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQ QSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHI PSTLKQQLLSLLTCIESYSRVAGTRRRR*