Clone RH61560 Report

Search the DGRC for RH61560

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:615
Well:60
Vector:pFlc-1
Associated Gene/TranscriptVhl-RA
Protein status:RH61560.pep: gold
Preliminary Size:537
Sequenced Size:961

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13221 2002-01-01 Sim4 clustering to Release 2
CG13221 2002-01-03 Blastp of sequenced clone
CG13221 2003-01-01 Sim4 clustering to Release 3
Vhl 2008-04-29 Release 5.5 accounting
Vhl 2008-08-15 Release 5.9 accounting
Vhl 2008-12-18 5.12 accounting

Clone Sequence Records

RH61560.complete Sequence

961 bp (961 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075555

> RH61560.complete
CACCACCGTAACTGATAAGAAGTGAATTTTATCTATACTTGTTGTTAGCT
TGTTGTGATTTGATTCAATCCAATTCCCACGGCTTGTGCAAACGTAAAAC
AACGAAAATTGATTTGGCAGCCATTGCAGATCGGCTTAGCACCCTGCTGG
AGATGGCGCTCCAAATAGCGCAGAACAACCGCGACGGCCAGCAGCTGGTG
GGCGCTGATCAGGGAAAGGTGGAGGTGTACGTGCTGTTTGCAAACACCAC
CTATCGCACCCTGGATCTGTACTGGGTGTGCGAGCGGGAGCGGGAGAACA
TGTACCTTACCCTCAAGCCCTTCGAGGAGGTGCGGGTGAACACGTTCACC
ACACACAGCTGGCTGTTCCGGGATTACTACACGGGCGAACGGATGCACGT
ACGCTCGCAGAGGATCTTTCAGCCGATTCGGGTGCGGGTACCCAAGAGCC
AGCAGAGTCCGGATCAGCTGGTTGACGTACGCAGCGAAGTGCTGATCCAC
TTTCCGATGAGATCGCTGCGCGAAAACTGCCTCTGGCTGGTCGCCCGCTG
GCTGATCCGGACGAGCAACGCGCCACGGAGGATTATCCACGGATACCACA
TACCCTCGACGCTGAAGCAACAGCTGCTCAGCCTGCTGACCTGCATCGAG
TCCTATTCCCGAGTGGCGGGCACGCGACGTCGGCGTTAGGAGCACACTCC
TAGTTGTTAGTTAAGAGGGCGGGTAATCATCTTAGGGACTGAGAGACAGG
CTTGATTTCCAAATAATTTAATAACTTTAATTGATTTCCATCCTGGTTTT
CGATTTTCGCTTATTACTTATGTACAAATTGGCTTGCATAGAGCTCTTTA
CAAGTTGGGCTACTACCATTGCATTGATTTTTCTGTATATTTAACAGATT
TCTTATACCTATGTATGTTCTATGTAAATAATTATGTATAAACCCAAAAA
AAAAAAAAAAA

RH61560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Vhl-RA 1308 Vhl-RA 5..944 5..944 4700 100 Plus
CG9062.a 3082 CG9062.a 2827..3082 944..689 1280 100 Minus
CG9062.b 3105 CG9062.b 2850..3105 944..689 1280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7167182..7168121 5..944 4700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11279730..11280669 5..944 4700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11280929..11281868 5..944 4700 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:38:36 has no hits.

RH61560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:39:46 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7167178..7168121 1..945 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:18 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..537 153..689 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:52:37 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..537 153..689 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:04:00 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..537 153..689 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:21 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..537 153..689 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:30:01 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..537 153..689 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:10 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 5..944 5..945 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:52:36 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 5..944 5..945 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:04:00 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..945 2..945 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:21 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 5..944 5..945 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:30:01 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
Vhl-RA 1..945 2..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:46 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279726..11280669 1..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:46 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279726..11280669 1..945 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:39:46 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11279726..11280669 1..945 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:04:00 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7167231..7168174 1..945 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:31 Download gff for RH61560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11280925..11281868 1..945 99   Plus

RH61560.pep Sequence

Translation from 152 to 688

> RH61560.pep
MALQIAQNNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENM
YLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQ
QSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHI
PSTLKQQLLSLLTCIESYSRVAGTRRRR*

RH61560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12540-PA 175 GF12540-PA 1..175 1..178 699 80.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20185-PA 178 GG20185-PA 1..178 1..178 933 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19949-PA 192 GH19949-PA 1..172 1..170 436 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Vhl-PB 178 CG13221-PB 1..178 1..178 935 100 Plus
Vhl-PA 178 CG13221-PA 1..178 1..178 935 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19906-PA 184 GI19906-PA 1..179 1..178 525 61.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17723-PA 188 GL17723-PA 1..171 1..169 618 66.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12133-PA 188 GA12133-PA 1..171 1..169 618 66.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21273-PA 178 GM21273-PA 1..178 1..178 934 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10785-PA 178 GD10785-PA 1..178 1..178 939 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15074-PA 184 GJ15074-PA 1..174 1..173 571 62.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21683-PA 195 GK21683-PA 25..187 12..176 615 67.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12873-PA 178 GE12873-PA 1..178 1..178 934 98.3 Plus

RH61560.hyp Sequence

Translation from 152 to 688

> RH61560.hyp
MALQIAQNNRDGQQLVGADQGKVEVYVLFANTTYRTLDLYWVCERERENM
YLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQPIRVRVPKSQ
QSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHI
PSTLKQQLLSLLTCIESYSRVAGTRRRR*

RH61560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Vhl-PB 178 CG13221-PB 1..178 1..178 935 100 Plus
Vhl-PA 178 CG13221-PA 1..178 1..178 935 100 Plus