Clone RH61745 Report

Search the DGRC for RH61745

Clone and Library Details

Library:RH
Tissue Source:Drosophila melanogaster adult head
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2001-04-30
Comments:Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:617
Well:45
Vector:pFlc-1
Associated Gene/TranscriptCG12998-RA
Protein status:RH61745.pep: gold
Preliminary Size:429
Sequenced Size:630

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12998 2002-01-01 Sim4 clustering to Release 2
CG12998 2002-01-03 Blastp of sequenced clone
CG12998 2003-01-01 Sim4 clustering to Release 3
CG12998 2008-04-29 Release 5.5 accounting
CG12998 2008-08-15 Release 5.9 accounting
CG12998 2008-12-18 5.12 accounting

Clone Sequence Records

RH61745.complete Sequence

630 bp (630 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075556

> RH61745.complete
GACAGCATTCGAGTGCCACACTTCGAGACGCACAGCAAAACAAACCAGGA
TCTACTCTCCGAGTCAGGACTAAAAGCTTAAAATCCCAAACCACACATAA
TGAAGGTATTCATTGTACTCTGCGCACTGGTGGCCTGTGTTTCGGCCGGA
TTGGTCCGATCCTCGGGCTGGGGATCGAATCCTTGGGGCGGCAGCAGCTC
CGGATGGAATAGTGGCTGGGTTGCCCAGCAGCCGCAAGTCATCAAGGTCA
TAAAGATCGGAGGAGGCGGCGGCTCCGGATGGGGCGGAAACTCTGGATGG
GGCGGTAACTCCGGATGGGGTAGCAACTCCGGATGGGGCGGCAACTCCGG
ATGGGGTGGAAACTCTGGTTGGAGCAGCGGCAACTCCGGATGGAACAGCA
ATGGATGGTCCAGTTCCAGCTCCAATAGTGGATGGTGGTAAAGAATCGAA
GAGCTACCATCTCTAGGAGACGAAAAATCCAAGCACAATCCCAATCCCGA
TCCCCTCTCTCCGCACCTGGTTCACAATCCACCCGATTTTATAACATAGT
TTTTAAGTACCATTTTTTTTTGTGTAACAAATAAATAAATGAATAAATCA
AAGGCATAAAGTTAAAAAAAAAAAAAAAAA

RH61745.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG12998-RA 613 CG12998-RA 2..613 2..613 3060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17108335..17108945 2..613 2950 99.2 Plus
chrX 22417052 chrX 17108606..17108687 309..393 195 84.7 Plus
chrX 22417052 chrX 17108642..17108726 273..354 195 84.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17218883..17219496 2..615 3070 100 Plus
X 23542271 X 17219154..17219235 309..393 195 84.7 Plus
X 23542271 X 17219190..17219274 273..354 195 84.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17226981..17227594 2..615 3070 100 Plus
Blast to na_te.dros performed 2019-03-15 22:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4138..4174 565..601 122 81.1 Plus

RH61745.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:17 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17108334..17108945 1..613 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:21 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..342 100..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:59 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..342 100..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:14 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..342 100..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:31 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..342 100..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:37 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..342 100..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:09 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 2..613 2..613 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:59 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 2..613 2..613 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:14 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..610 4..613 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:31 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 2..613 2..613 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:37 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
CG12998-RA 1..612 2..613 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
X 17218882..17219494 1..613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
X 17218882..17219494 1..613 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
X 17218882..17219494 1..613 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:14 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17112915..17113527 1..613 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:22 Download gff for RH61745.complete
Subject Subject Range Query Range Percent Splice Strand
X 17226980..17227592 1..613 99   Plus

RH61745.pep Sequence

Translation from 99 to 440

> RH61745.pep
MKVFIVLCALVACVSAGLVRSSGWGSNPWGGSSSGWNSGWVAQQPQVIKV
IKIGGGGGSGWGGNSGWGGNSGWGSNSGWGGNSGWGGNSGWSSGNSGWNS
NGWSSSSSNSGWW*

RH61745.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19107-PA 118 GG19107-PA 1..118 1..113 431 91.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG12998-PB 113 CG12998-PB 1..113 1..113 660 100 Plus
CG12998-PA 113 CG12998-PA 1..113 1..113 660 100 Plus
CG34327-PA 220 CG34327-PA 15..131 7..109 182 40.5 Plus
CG13376-PB 200 CG13376-PB 1..147 1..112 178 34.2 Plus
CG34227-PA 104 CG34227-PA 54..102 55..113 177 50.8 Plus
CG34227-PA 104 CG34227-PA 55..101 35..98 176 45.3 Plus
CG34327-PA 220 CG34327-PA 57..174 21..113 170 39.2 Plus
CG13376-PD 204 CG13376-PD 1..151 1..112 170 34 Plus
CG13376-PC 193 CG13376-PC 18..140 22..112 168 36.7 Plus
CG34327-PA 220 CG34327-PA 133..218 14..112 163 43.3 Plus
CG5172-PD 172 CG5172-PD 10..116 6..102 160 37.4 Plus
CG12523-PB 250 CG12523-PB 1..159 1..111 159 34.6 Plus
CG12523-PA 250 CG12523-PA 1..159 1..111 159 34.6 Plus
CG13376-PC 193 CG13376-PC 57..153 15..111 158 37.5 Plus
Top3alpha-PA 1250 CG10123-PA 770..831 54..111 156 50 Plus
CG13376-PB 200 CG13376-PB 86..199 15..112 153 34.2 Plus
CG13376-PD 204 CG13376-PD 90..203 15..112 153 34.2 Plus
CG13376-PC 193 CG13376-PC 79..192 15..112 153 34.2 Plus
CG12523-PB 250 CG12523-PB 135..242 15..113 152 36.9 Plus
CG12523-PA 250 CG12523-PA 135..242 15..113 152 36.9 Plus
CG14191-PA 193 CG14191-PA 1..141 1..108 150 31.7 Plus
CG12523-PB 250 CG12523-PB 66..192 1..109 149 36.2 Plus
CG12523-PA 250 CG12523-PA 66..192 1..109 149 36.2 Plus
CG34327-PA 220 CG34327-PA 83..183 21..112 144 35 Plus
Top3alpha-PA 1250 CG10123-PA 766..844 17..100 144 39.1 Plus
CG15597-PB 149 CG15597-PB 1..146 1..113 143 30.6 Plus
CG13376-PC 193 CG13376-PC 2..97 18..112 140 35.8 Plus
CG17032-PB 312 CG17032-PB 116..172 54..110 140 43.9 Plus
CG17032-PA 312 CG17032-PA 116..172 54..110 140 43.9 Plus
CG7296-PB 161 CG7296-PB 1..137 1..111 138 34.5 Plus
CG7296-PA 161 CG7296-PA 1..137 1..111 138 34.5 Plus
CG11458-PA 98 CG11458-PA 9..98 5..98 135 36 Plus
CG5172-PC 106 CG5172-PC 10..98 6..110 135 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13498-PA 119 GM13498-PA 1..119 1..113 459 94.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24844-PA 119 GD24844-PA 1..119 1..113 459 94.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17653-PA 121 GE17653-PA 1..52 1..53 181 94.3 Plus

RH61745.hyp Sequence

Translation from 99 to 440

> RH61745.hyp
MKVFIVLCALVACVSAGLVRSSGWGSNPWGGSSSGWNSGWVAQQPQVIKV
IKIGGGGGSGWGGNSGWGGNSGWGSNSGWGGNSGWGGNSGWSSGNSGWNS
NGWSSSSSNSGWW*

RH61745.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG12998-PB 113 CG12998-PB 1..113 1..113 660 100 Plus
CG12998-PA 113 CG12998-PA 1..113 1..113 660 100 Plus
CG34327-PA 220 CG34327-PA 15..131 7..109 182 40.5 Plus
CG13376-PB 200 CG13376-PB 1..147 1..112 178 34.2 Plus
CG34227-PA 104 CG34227-PA 54..102 55..113 177 50.8 Plus
CG34227-PA 104 CG34227-PA 55..101 35..98 176 45.3 Plus
CG34327-PA 220 CG34327-PA 57..174 21..113 170 39.2 Plus
CG34327-PA 220 CG34327-PA 133..218 14..112 163 43.3 Plus
CG34327-PA 220 CG34327-PA 83..183 21..112 144 35 Plus