RH61745.complete Sequence
630 bp (630 high quality bases) assembled on 2002-01-03
GenBank Submission: AY075556
> RH61745.complete
GACAGCATTCGAGTGCCACACTTCGAGACGCACAGCAAAACAAACCAGGA
TCTACTCTCCGAGTCAGGACTAAAAGCTTAAAATCCCAAACCACACATAA
TGAAGGTATTCATTGTACTCTGCGCACTGGTGGCCTGTGTTTCGGCCGGA
TTGGTCCGATCCTCGGGCTGGGGATCGAATCCTTGGGGCGGCAGCAGCTC
CGGATGGAATAGTGGCTGGGTTGCCCAGCAGCCGCAAGTCATCAAGGTCA
TAAAGATCGGAGGAGGCGGCGGCTCCGGATGGGGCGGAAACTCTGGATGG
GGCGGTAACTCCGGATGGGGTAGCAACTCCGGATGGGGCGGCAACTCCGG
ATGGGGTGGAAACTCTGGTTGGAGCAGCGGCAACTCCGGATGGAACAGCA
ATGGATGGTCCAGTTCCAGCTCCAATAGTGGATGGTGGTAAAGAATCGAA
GAGCTACCATCTCTAGGAGACGAAAAATCCAAGCACAATCCCAATCCCGA
TCCCCTCTCTCCGCACCTGGTTCACAATCCACCCGATTTTATAACATAGT
TTTTAAGTACCATTTTTTTTTGTGTAACAAATAAATAAATGAATAAATCA
AAGGCATAAAGTTAAAAAAAAAAAAAAAAA
RH61745.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:56:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12998-RA | 613 | CG12998-RA | 2..613 | 2..613 | 3060 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:58:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 17108335..17108945 | 2..613 | 2950 | 99.2 | Plus |
chrX | 22417052 | chrX | 17108606..17108687 | 309..393 | 195 | 84.7 | Plus |
chrX | 22417052 | chrX | 17108642..17108726 | 273..354 | 195 | 84.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:35:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:58:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 17218883..17219496 | 2..615 | 3070 | 100 | Plus |
X | 23542271 | X | 17219154..17219235 | 309..393 | 195 | 84.7 | Plus |
X | 23542271 | X | 17219190..17219274 | 273..354 | 195 | 84.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 17226981..17227594 | 2..615 | 3070 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 22:58:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmir\worf | 4174 | Dmir\worf WORF 4174bp Derived from AY144572. | 4138..4174 | 565..601 | 122 | 81.1 | Plus |
RH61745.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:17 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 17108334..17108945 | 1..613 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:51:21 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..342 | 100..441 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:59 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..342 | 100..441 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:24:14 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..342 | 100..441 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:31 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..342 | 100..441 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:37 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..342 | 100..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:08:09 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 2..613 | 2..613 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:59 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 2..613 | 2..613 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:24:14 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..610 | 4..613 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:31 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 2..613 | 2..613 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:37 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12998-RA | 1..612 | 2..613 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17218882..17219494 | 1..613 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17218882..17219494 | 1..613 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:17 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17218882..17219494 | 1..613 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:24:14 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 17112915..17113527 | 1..613 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:20:22 Download gff for
RH61745.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 17226980..17227592 | 1..613 | 99 | | Plus |
RH61745.pep Sequence
Translation from 99 to 440
> RH61745.pep
MKVFIVLCALVACVSAGLVRSSGWGSNPWGGSSSGWNSGWVAQQPQVIKV
IKIGGGGGSGWGGNSGWGGNSGWGSNSGWGGNSGWGGNSGWSSGNSGWNS
NGWSSSSSNSGWW*
RH61745.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:17:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19107-PA | 118 | GG19107-PA | 1..118 | 1..113 | 431 | 91.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12998-PB | 113 | CG12998-PB | 1..113 | 1..113 | 660 | 100 | Plus |
CG12998-PA | 113 | CG12998-PA | 1..113 | 1..113 | 660 | 100 | Plus |
CG34327-PA | 220 | CG34327-PA | 15..131 | 7..109 | 182 | 40.5 | Plus |
CG13376-PB | 200 | CG13376-PB | 1..147 | 1..112 | 178 | 34.2 | Plus |
CG34227-PA | 104 | CG34227-PA | 54..102 | 55..113 | 177 | 50.8 | Plus |
CG34227-PA | 104 | CG34227-PA | 55..101 | 35..98 | 176 | 45.3 | Plus |
CG34327-PA | 220 | CG34327-PA | 57..174 | 21..113 | 170 | 39.2 | Plus |
CG13376-PD | 204 | CG13376-PD | 1..151 | 1..112 | 170 | 34 | Plus |
CG13376-PC | 193 | CG13376-PC | 18..140 | 22..112 | 168 | 36.7 | Plus |
CG34327-PA | 220 | CG34327-PA | 133..218 | 14..112 | 163 | 43.3 | Plus |
CG5172-PD | 172 | CG5172-PD | 10..116 | 6..102 | 160 | 37.4 | Plus |
CG12523-PB | 250 | CG12523-PB | 1..159 | 1..111 | 159 | 34.6 | Plus |
CG12523-PA | 250 | CG12523-PA | 1..159 | 1..111 | 159 | 34.6 | Plus |
CG13376-PC | 193 | CG13376-PC | 57..153 | 15..111 | 158 | 37.5 | Plus |
Top3alpha-PA | 1250 | CG10123-PA | 770..831 | 54..111 | 156 | 50 | Plus |
CG13376-PB | 200 | CG13376-PB | 86..199 | 15..112 | 153 | 34.2 | Plus |
CG13376-PD | 204 | CG13376-PD | 90..203 | 15..112 | 153 | 34.2 | Plus |
CG13376-PC | 193 | CG13376-PC | 79..192 | 15..112 | 153 | 34.2 | Plus |
CG12523-PB | 250 | CG12523-PB | 135..242 | 15..113 | 152 | 36.9 | Plus |
CG12523-PA | 250 | CG12523-PA | 135..242 | 15..113 | 152 | 36.9 | Plus |
CG14191-PA | 193 | CG14191-PA | 1..141 | 1..108 | 150 | 31.7 | Plus |
CG12523-PB | 250 | CG12523-PB | 66..192 | 1..109 | 149 | 36.2 | Plus |
CG12523-PA | 250 | CG12523-PA | 66..192 | 1..109 | 149 | 36.2 | Plus |
CG34327-PA | 220 | CG34327-PA | 83..183 | 21..112 | 144 | 35 | Plus |
Top3alpha-PA | 1250 | CG10123-PA | 766..844 | 17..100 | 144 | 39.1 | Plus |
CG15597-PB | 149 | CG15597-PB | 1..146 | 1..113 | 143 | 30.6 | Plus |
CG13376-PC | 193 | CG13376-PC | 2..97 | 18..112 | 140 | 35.8 | Plus |
CG17032-PB | 312 | CG17032-PB | 116..172 | 54..110 | 140 | 43.9 | Plus |
CG17032-PA | 312 | CG17032-PA | 116..172 | 54..110 | 140 | 43.9 | Plus |
CG7296-PB | 161 | CG7296-PB | 1..137 | 1..111 | 138 | 34.5 | Plus |
CG7296-PA | 161 | CG7296-PA | 1..137 | 1..111 | 138 | 34.5 | Plus |
CG11458-PA | 98 | CG11458-PA | 9..98 | 5..98 | 135 | 36 | Plus |
CG5172-PC | 106 | CG5172-PC | 10..98 | 6..110 | 135 | 35.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:17:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13498-PA | 119 | GM13498-PA | 1..119 | 1..113 | 459 | 94.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:17:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24844-PA | 119 | GD24844-PA | 1..119 | 1..113 | 459 | 94.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:17:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17653-PA | 121 | GE17653-PA | 1..52 | 1..53 | 181 | 94.3 | Plus |
RH61745.hyp Sequence
Translation from 99 to 440
> RH61745.hyp
MKVFIVLCALVACVSAGLVRSSGWGSNPWGGSSSGWNSGWVAQQPQVIKV
IKIGGGGGSGWGGNSGWGGNSGWGSNSGWGGNSGWGGNSGWSSGNSGWNS
NGWSSSSSNSGWW*
RH61745.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12998-PB | 113 | CG12998-PB | 1..113 | 1..113 | 660 | 100 | Plus |
CG12998-PA | 113 | CG12998-PA | 1..113 | 1..113 | 660 | 100 | Plus |
CG34327-PA | 220 | CG34327-PA | 15..131 | 7..109 | 182 | 40.5 | Plus |
CG13376-PB | 200 | CG13376-PB | 1..147 | 1..112 | 178 | 34.2 | Plus |
CG34227-PA | 104 | CG34227-PA | 54..102 | 55..113 | 177 | 50.8 | Plus |
CG34227-PA | 104 | CG34227-PA | 55..101 | 35..98 | 176 | 45.3 | Plus |
CG34327-PA | 220 | CG34327-PA | 57..174 | 21..113 | 170 | 39.2 | Plus |
CG34327-PA | 220 | CG34327-PA | 133..218 | 14..112 | 163 | 43.3 | Plus |
CG34327-PA | 220 | CG34327-PA | 83..183 | 21..112 | 144 | 35 | Plus |